Friday, August 5, 2016

SANATANA DHARMA , HINDUISM EXHUMED AND RESURRECTED, PART 62 - CAPT AJIT VADAKAYIL



THIS POST IS CONTINUED FROM PART 61, BELOW--





NONE OF THE SO CALLED ANCIENT CIVILIZATIONS OF THE PLANET HAVE LEFT BEHIND ANYTHING OF CEREBRAL VALUE IN WRITING-- ABSOLUTELY  NOTHING !!     

80% OF OUR VEDAS ( SAMHITAS/ BRAHMANAS/ ARANYAKAS/ UPANSIHADS) HAVE BEEN STOLEN / DESTROYED BY THE WHITE INVADER.    

THE JEALOUS WHITE MAN  POST DATED OUR ANCIENT WORKS PENNED DOWN IN 5000 BC,   TO SUIT THEIR UNDERSTANDING OF BIG BANG DATED AT A RIDICULOUS 4004 BC.    

IN THIS INTERNET AGE, IT IS PAY BACK TIME !   



THE WORLD SHALL KNOW THE GLORY OF ANCIENT INDIA  !! 






CHECK OUT THE SOUND OF  PATANJALIs YOGA SUTRAS PENNED DOWN 7000 YEARS AGO, WHEN THE REST OF THE WORLD WERE RUNNING AROUND NAKED DOING GRUNT GRUNT




CHAPTER I-  SAMADHI PADA-   CONTEMPLATION
atha yoganushasanam
yogashchittavrittinirodhah
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pramannaviparyayavikalpanidrasmritayah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
vitarkavicharanandasmitaroopanugamatsanprajnatah
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tajjapastadarthabhavanam
tatah pratyakchetanadhigamopyantarayabhavashch
vyadhistyanasanshayapramadalasyaviratibhrantidarshanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah
duhkhadaurmanasyanggamejayatvashvasaprashvaavikshepasahabhuvah
tatpratishedhartham ekatattvabhyasah
maitreekarunamuditopekshanansukhaduhkhapunyapunyavishayananbhavanatashchittaprasadanam
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
ksheennavritterabhijatasyevmanergrahitrigrahannagrahyeshutatsthatadangjanatasamapattih
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih

CHAPTER II - SADHANA PADA-- PRACTISE

tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
anityashuchiduhkhanatmasunityashuchisukhatmakhyatiravidya
drigdarshanashaktyorekatmatevasmita
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
dhyanaheyastadvrittayah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
samadhisiddhirishvarapranidhanat
sthirasukham aasanam
prayatnashaithilyanantasamapattibhyam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah

CHAPTER III – VIBHOOTI PADA - MANIFESTATION

deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
sarvarthataikagratayoh
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
parinamatrayasanyamadatitanagatajnanam
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
sthoolasvaroopasookshmanvayarthavattvasamyamadbhootajayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti

CHAPTER IV--  KAIVALYA PADA --  LIBERATION

janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
nirmannachittanyasmitamatrat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
chiterapratisankramayastadakarapattausvabuddhisanvedanam
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah 
purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti




3.04--   trayam ekatra samyama


These three together - dharana, dhyana and samadhi - make up integration or samyama.   In samyama the three are a single thread, evolving from uninterrupted attention to samadhi.


The word “samyama” is comprised of two parts: sam, meaning “together,” and yama, meaning “discipline.”. It is the tool used to reach the subtler levels of non-attachment. A sharp tool of discrimination used for deep introspection, it uncovers our true nature. The finest discrimination eventually leads to liberation, which then allows us to move past our ignorance and ego. The only prerequisit for this practice is to have some inner silence when we sit for meditation. The nervous system also goes to silence with the mind, and our metabolism slows way down.  The yogi loses does NOT get a hop even if Miss World does a naked lapdance .  Semen retention is a piece of cake –this is NOT the way Gandhi did it using naked teenage girls under the same blanket and mutual enemas.


Kachrawaal is slipping into Paranoid Schizophrenia boosted by faalthu EGO —Samayama will do him a world of good.    I wish him well-- show some fuckin' LEVEL HEADED behavior after your 12 day Vipassana session. 

Surprise us, Khujliwaal  ! 

Remember "CM of Delhi" is a very small post !!




Samyama is the greatest synthesis of human consciousness, the smooth seamless synthesis of three: dharana, dhyan, samadhi. Samyama, is a state of immobility, and a samyami is one who represses his passions and stays motionless.  The following analogy illustrates the organic relationship between dharana, dhyana and samadhi. When one contemplates a diamond, one at first sees with great clarity the gem itself. Gradually one becomes aware of the light glowing from its centre. As awareness of the light grows, awareness of the stone as an object diminishes. Then there is only brightness, no source, no object. When the light is everywhere, that is samadhi.  Dharana brings stability in mind, dhyana develops maturity in intelligence and samadhi acts to disperse the consciousness.   Dharana, dhyana and samadhi intermingle to become samyama, or integration. The intermingling of mind, intelligence and consciousness is samyama of the three. The vision of the seer is equivalent to nirbija samadhi. Advanced Yogis can reach this state by mere yoga nidra -- tip of forefinger meeting thumb.  A yogi who is can do samyama defeats all 'cognitive obscurations' ( kleshas).  Samyama means perfect control of the mind.  Here it is a technical name for three inseparable processes of Dharana, Dhyana and Samadhi taken collectively.  Samyama is the state of resting in deep inner silence  (samadhi), along with the ability to pick up a thought (focus/dharana) and let it go inward (meditation/dhyana). If thoughts are coming, we just let them go without entertaining them. In samyama practice we do not entertain the mantra either. We start by not favoring anything but being easy in our silence, however much silence we have from our just completed meditation session, and naturally present in us from our months or years of daily meditation. This is the starting point for samyama — silence. The only prerequisite for doing samyama practice is having some inner silence. Because releasing into silence puts us in touch with our inner stillness, beyond the reflections and reactions of surface thinking. We suddenly have “broadband access” to our deepest levels of will and awareness, if only we will stay out of our own way by allowing our awareness to rest in silence, after we have released the thought or feeling, using the samyama technique. This can be difficult at first for a raw yogi aspirant, but with practice and faith (trusting the process and the answers that come up from this stillness) it gets easier and more natural.Samyama is a practice by which the yogi can gain tremendous knowledge and power. It can be applied with a focus on any one object at a time. When it is practiced on an object, the yogi practicing samyama is able to dive deep and find the truest knowledge of the object. The yogi should begin by focusing on tangible objects, then refining their practice as they shift to subtler objects. Regular practice of samyama will firm a yogi’s knowledge of samadhi, making it more natural and lucid. Don’t make the LUST emotion stronger by thinking about it, we just bring it up and before the mind can grab it and make it a full-fledged story, we drop it into stillness. 




3.05 ---tajjayat prajnaalokah

From mastery of samyama comes the light of awareness and insight.


When mastery of integration (samyama) is achieved, the splendour of wisdom and insight shines brilliantly, harmonising the known with the knowable and revealing the soul. Awareness and cognition become firmer and sharper by direct spiritual perception. Ordinarily, human intelligence flutters from object to object and from place to place, making it impossible to interpenetrate fully into any one thing. In samyama, the knower comes closer and closer to the known and, unifying in it, loses his separateness. When one has succeeded in making this Samyama, all powers come under his control. Samyama should be first applied to gross things, when when you begin to get knowledge of the gross, slowly, by stages, it should be brought to finer things. Through the mastery of that three-part process of samyama, the light of knowledge, transcendental insight, or higher consciousness (prajna) dawns, illumines, flashes, or is visible. Prajña is used to refer to the highest and purest form of wisdom, intelligence and understanding. Pragya is the state of wisdom which is higher than the knowledge obtained by reasoning and inference. The Sanskrit word Praja is the combination of "प्र (pra-)" which prefix means – before, forward, fulfiller, and used as the intensifier but rarely as a separate word and "ज्ञ (jna)" which means - knowing or familiar with. The third chapter of the Aitareya Upanishad teaches – तत्प्रज्ञानेत्रम् प्रज्ञाने प्रतिष्ठितं प्रज्ञानेत्रो लोकः प्रज्ञानं ब्रह्म (III.i.3) that all that exist, all phenomena cosmic and psychical, are rooted in Prajna i.e. Consciousness, and Consciousness is Brahman. The main theme of Kaushitaki Upanishad is that without Prajaā the senses do not work, which is knowledge, for by knowledge one sees clearly; Prajñā is Brahman and all things are rooted in Brahman. Prana is Prajna, self-consciousness. It is Prajna that takes possession of Speech, and by speech one obtains words; takes possession of the nose, and one obtains odours; takes possession of the eye, and one obtains all forms; takes possession of the ear, and one obtains all sounds; takes possession of the tongue, and one obtains all tastes of food; takes possession of the hands, and one obtains all actions; takes possession of the body, and one obtains pleasure and pain; takes possession of the organ, one obtains happiness, joy and offspring; takes possession of the feet, one obtains all movements and takes possession of mind, and one obtains all thoughts, without Prajñā, no thoughts succeed. The Vedantasara tells us that Brahman is to be thought of as being Nirguna, without attributes; Brahman is the sole reality, everything else is Anatman, non-existence and non-knowledge., Prajna (प्राज्ञ) – अस्य ज्ञात्वमस्पष्टोपाधितयानतिप्रकाशकत्वात् ||४४|| Intelligence in its invisible form refers to Brahman – आनन्दभुक् चेतोमुखः प्राज्ञः ("Prājña, the enjoyer of bliss, with Consciousness for its aid" (Mandukya Upanishad 5)), the all-knowing reality, in its visible form it is the parviscient Jiva which is able to differentiate itself from Ishvara – सता सोम्य तदा सम्पन्नो भवति ("Then (in dreamless sleep), my dear, he (Jiva) becomes one with Existence (Ishvara) " (Chandogya Upanishad VI.viii.1)).[14]



3.06 --- tasya bhoomishu viniyogah


Samyama can be applied in various spheres to derive its usefulness.


Patanjali explains that this insight and wisdom needs to be decently circularised in various spheres of one's life. One who has not mastered the lower stages cannot attain the higher, nor can he jump the intermediate stages. If eash stage is followed in turn, one becomes familiarised with them by degrees, and full insight develops. This sutra affirms that no one can expect success or mastery without regular practice, and also warns one not to jump to higher stages of practice without first establishing a firm foundation through the primary steps of yoga. Patanjali does not mention kundalini, but speaks of the energy of nature flowing abundantly in a yogi . Kundalini is a neologism. This energy of nature (prakrti shakti) was originally known as agni or fire. Later yogis called this fire kundalini (the coiled one) as its conduit in the body is coiled 3.5 times at the base of the spine. It is, however, clear that many who undergo an overpowering experience of fusion with the universal consciousness reap, through their unpreparedness, more pain than benefit. To the lucky, healthy few, such an experience can serve as an incite to begin a true spiritual search, but to many others it can bring ruthless physical and psychological disorders. The eightfold path, although it may appear mystical to the uninitiated, is ultimately a path of spiritual evolution whose motto might well be 'safety first'. The foundation must be secure, as Patanjali emphasises when he places yama and niyama first, and when he marks an explicit step up between asana and pranayama. Yoga is the teacher of yoga. The power of yoga manifests through yoga alone. He who does not become careless, negligent or inattentive, he alone rests in yoga and enjoys yoga. 'Yogena yogojhatavya yogo yogatpravartate yo pramattastu yogena sa yogo ramate dram.' That three-part process of samyama is gradually applied to the finer planes, states, or stages of practice. The finer states naturally come forward: When the practice of samyama is applied to the finer states, the subtler aspects naturally reveal themselves during the deeper practices. It does not necessarily mean that you will know the details of those ahead of time. Rather, the inner journey itself reveals the subtler aspects. Stages are usually not skipped: Typically, the stages are experienced one after the other, as they reveal themselves, without skipping any of the stages of subtle experience along the way. We need not experience all the stages: Even though the subtle states naturally come forward in a systematic order, it is not essential that we seek out and experience each and every one of the stages.  Samyama may not be needed on all of the stages because proficiency might be attained through the gift of grace. Samyama may be applied in various spheres to derive its usefulness. It must be applied stage by stage. Samyama must be developed gradually.  That three-part process of samyama is gradually applied to the finer planes, states, or stages of practice. This is a note of  warning not to attempt to go too fast.




3.07 --- trayam antaranggan poorvebhyah

These three aspects of yoga are internal, compared to the former five.


Compared to the former five aspects of yoga, it may he seen that dharana, dhyana and samadhi are more subtle, internal, intimate and subjective practices. The first five, which deal with the seen or cognisable sheaths, are called the external quest. Yama purifies the organs of action; niyama, the senses of perception; asana cleanses the physical and organic aspects of the body; pranayama stops wastage of energy and increases stamina; pratyahara cleanses the mind. More intimately, dharana develops and sharpens intelligence, dhyana purifies consciousness and samadhi leads consciousness towards the soul. These three are directly involved in the subtle sheaths of mind, intelligence and consciousness, and are very close to the spiritual heart. They directly affect the spiritual path, and are therefore called the inner quest, or sabtja samadhi, because the sadhaka now has one-pointed consciousness. In samadhi pada, Patanjali explained that truth-bearing wisdom (rtambhara prajna) is the threshold between sabtja and nirbija samadhis. Here he describes samyama as the penultimate step towards nirbija samadhi. In the next sutra Patanjali explains that samyama is external to nirbija samadhi, and then proceeds, in 111.9-16, to interpenetrate the transformations in the very substance of the consciousness, leading one to experience its finest state, which appears to be subtler than samyama. Outer awareness falls away: When asana (postures), pranayama (breath/prana), senses (pratyahara) are seen to be external, they have been left behind, and fall away from awareness. This is much like the way the external world seems to vanish for us when we are intimately involved with our body and breath awareness practices. It is as if the body, breath, and senses no longer exist for us; we have gone beyond them, now truly entering into the mind field. The mind field is now perceived in a very different way, compared to the noisy, monkey mind when earlier trying to just sit still.  Concentration, meditation, and samadhi are intimate: When asana, pranayama, and pratyahara (body, breath, senses) fall away, or are left behind, then concentration (dharana), meditation (dhyana), and samadhi are seen as quite intimate or internal. The boundary line between out there and in here has significantly shifted; we are now ready to explore the subtler realities, and to begin the process of setting those aside as well (vairagya, non-attachment, 1.15-1.16), still seeking the eternal Self at the core of our being (1.3).  These three [dharana, dhyana and samadhi] are more internal than the preceding five limbs. These three are more direct aids to experience than the five limbs previously described. These three are nearer than those that precede. Before these we had the Pranayama, the Asana, the Yama and Niyama; these are external parts of these three— Dharana, Dhyana, and Samadhi. Yet these latter even are external to the seedless Samadhi. When a man has attained to them he may attain to omniscience and omnipresence, but that would not be salvation. These three would not make the mind Nirvikalpa, changeless, but would leave the seeds for getting bodies again; only when the seeds are, as the Yogi says, “fried,” do they lose the possibility of producing further plants. These powers cannot fry the seed Antarangam has nothing to do with sexology as some Tamil Agama TV channels are propagating


Tulsidas wrote in Awadhi language about the twin sons of Rama, ( Luv/ Kush ) who were born in the forest after Rama kicked his pregnant wife Sita out. We Indians never heard this bullshit story till the white invader came to India.

Luv/ Kush captures the white ashwamedha horse of Rama. This bullshit episode also never happened.

http://ajitvadakayil.blogspot.in/2014/09/ashwamedha-yagam-bloodless-sacrifice.html

Jew Rothschild created Awadhi language ( from a dialect of Nepal ) to inject poison into Hinduism.

Same way Jew Rothschild created the Urdu language to divide and rule.

Jew Rothschild used the FAKE and backdated Bhakti movement, using the FAKE and backdated DASAs to shatter the bed rock Sanatana Dharma ( Laws of Karma/ Moksha ).

He was unsuccessful though.

It does NOT matter if you sing bhajans in praise of the lord throughout the day, take a dip hundreD times in Kashi—you cannot escape the laws of Karma. Nobody can raise the kundalini unless the Karmic baggage is worked out and is approaching zero.

The Guru Granth Sahib is packed with DASA verses.

http://ajitvadakayil.blogspot.in/2013/07/unknown-history-of-sikhs-and-sikhism.html




3.08 --- tad api bahiranggan nirbijasy


Similarly, samyama is external when compared to seedless (nirbija) samadhi.



Even this perfection of dharana, dhyana and samadhi appears external to one who has experienced the seedless samadhi, the direct vision of the soul. Citta is divided into five states: 1. ksipta, a mental force, which is scattered, in a state of disarray and neglect 2. mudha, a foolish and dull state 3. viksipta, agitated and distracted, neither marshalled nor controlled 4. ekagra, a state of one-pointed attention 5. niruddha, where everything is restrained, for the sadhaka to reach the threshold of kaivalya. As samyama is dependent on a support or a form, it is called 'external' compared to nirbija samadhi. Once the vehicles of nature (body, organs of action, senses of perception, mind, intelligence, reason and consciousness) cease to function, the soul (atman) shines forth, and the sadhaka dwells in kaivalya and not on its threshold. Sleep comes naturally when mental activities cease without effort. In the same manner, perfection in sabtja samadhi takes one towards the seedless state of samadhi or kaivalya, as smoothly as falling asleep. The soul surfaces of its own accord.All eight rungs of the Yoga Sutras come to be seen as external practices, when considered in relation to nirbija samadhi. The state where the mind has no impressions of any sort and nothing is beyond its reach [nirbijah samadhi] is more intricate than the state of directing the mind towards an object [samadhi]. However, these three practices are external, and not intimate compared to nirbija samadhi, which is samadhi that has no object, nor even a seed object on which there is concentration.






3.09 --- vyutthananirodhasanskarayorabhibhavapradurbhavau nirodhakshannachittanvayo
Nirodhaparinamah



Study of the silent moments between rising and restraining subliminal impressions is the transformation of consciousness towards restraint (nirodha parinamah).




Transformation by restraint of consciousness is achieved by study of the silent moments that occur between the rising of impressions and one's impulse to hold them back, and between the restraining impulse and the resurgence of thought. Sensory involvement leads to attachment, desire, frustration and anger. These usher in disorientation, and the eventual decay of one's true intelligence. Through the combined techniques and resources of yama, niyama, asana, pranayama and pratyahara one learns control. These are all external means of restraining consciousness, whether one focuses on God, or the breath, or in an asana by learning to direct and disseminate consciousness. All this learning develops in the relationship between subject and object. It is relatively simple because it is a relative, dual process. Cutting one's ties to sense objects within one's own consciousness carries immensely more weight than any severance from outside objects; if this was not so, a prisoner in solitary confinement would be halfway to being a yogi. Through the inner quest, the inner aspects of desire, attraction and aversion are brought to an end. Nirodha parinama is associated with the method used in meditation, when dharana loses its sharpness of attention on the object, and intelligence itself is brought into focus. In dharana and nirodha parinama, observation is a dynamic initiative. Through nirodha parinama, transformation by restraint or suppression, the consciousness learns to calm its own fluctuations and distractions, deliberate and non-deliberate. The method consists of noticing, then conquering and finally enlarging those subliminal pauses of silence that occur between rising and restraining thoughts and vice versa. As long as one impression is replaced by a counter-impression, consciousness rises up against it. This state is called vyutthana citta, or vyutthana samskara (rising impressions). Restraining the rising waves of consciousness and overcoming these impressions is nirodha citta or nirodha samskara. The precious psychological moments of intermission (nirodhaksana) where there is stillness and silence needs to be prolonged into extra-chronological moments of consciousness, without beginning or end. The key to understanding this wheel of mutations in consciousness is to be found in the breath. Between each inbreath and outbreath, one experiences the cessation of breath for a split second. Without this gap, one cannot inhale or exhale. This interval between each breath has another advantage - it allows the heart and lungs to rest. This rest period is called 'savasana' of the heart and lungs. The yogis who had discovered pranayama called this natural space kumbhaka, and advised humans to prolong its duration. So, there are four movements in each breath - inhalation, pause, exhalation and pause. Consciousness, too, has four movements - rising consciousness, a quiet state of consciousness, restraining consciousness and a quiet state of consciousness.Inhalation actually generates thought-waves, while exhalation helps to restrain them . The pauses between breaths, which take place after inhalation and exhalation are akin to the intervals between each rising and restraining thought. The mutation of breath and mutation of consciousness are thus identical, because both are silent periods for the physiological and intellectual body. They are moments of void in which a sense of emptiness is felt. Sadhakas are advised by Patanjali to transform this sense of emptiness into a dynamic whole, as single-pointed attention to no-pointed attentiveness This will become the second mode - samadhi pannama. In this process one often loses awareness on account of suppression and distraction. Having understood these silent intervals, one has to prolong them, as one prolongs breath retention, so that there is no room for generation or restraint of thoughts (Lord Krishna says in the Gita that 'What is night for other beings, is day for an awakened yogi and what is night for a yogi is day for others' (11.69) This sutra conveys the same idea. When generating thoughts and their restraint keep the seeker awake, it is day for him, but night for the seer. When the seer is awake in the prolonged spaces between rising and restraining thought, it is day for him, but night for the seeker. To understand this more clearly, one can imagine the body as a lake. The mind floats on its surface, but the seer is hidden at the bottom. This is darkness for the seer. Yoga practice causes the mind to sink and the seer to float. This is day for the seer. Just as one feels refreshed after a sound sleep, the seer's consciousness is refreshed as he utilises this prolonged pause for rejuvenation and recuperation. But at first, it is difficult to educate the consciousness to restrain each rising thought. It is against the thought current (pratipaksa) and hence induces restlessness, while the movement from restraint towards rising thought is with the current (paksa), and brings restfulness. To transform the consciousness into a pure sattvic state of dynamic silence, one must learn by repeated effort to prolong the intermissions . If no impressions are allowed to intrude, the consciousness will remain fresh, and rest in its own abode. This is ekagrata pannama. Consciousness has three dharmic characteristics - to wander, to be restrained and to remain silent. The silent state must be transformed into a dynamic but single state of awareness. Patanjali warns that in restraint old impressions may re-emerge - the sadhaka must train to react instantly to such appearances and cut them off in their source. Each act of restraint re-establishes a state of restfulness. This is dharma pannama. When a serene flow of tranquillity is maintained without interruption, then samadhi pari-qatna and laksana pannama begin. During this phase the sadhaka may become trammeled in a spiritual desert. At this point he must persevere to reach oneness with the soul and abide in that state (avastha pannama) eternally. This final goal is reached through ekagrata pannama. Letting go of the audience: Imagine that you are in a lecture hall several minutes before the speaker has come to give his  talk. All of the people are standing around the lecture hall, and the room is filled with a loud rumble of the collective voices of many conversations. You are watching this, taking it all in, with your mind pulling your senses here and there. Then, the speaker enters the hall, walks to the podium, and begins to speak. Two things happen simultaneously: your attention moves away from all of the other people, while at the same time, your attention becomes directed towards the speaker. Mastery over transitions: The transition away from the people in the audience is somewhat like nirodhah parinima (the transition of suspension), and the companion transition of attention moving towards the speaker is somewhat like samadhi parinima (the transition to absorption. When the attention repeatedly remains with the speaker, this is somewhat like ekagra parinima (the transition where the same absorption repeatedly arises and subsides.. It is the mastery over that process of transition itself that the Yogi is seeking. If you have mastery over these processes of transition, then you have mastery over all of the thought patterns, which might otherwise control your mind, thoughts, actions, and speech. There is a convergence with the transitions: The samskaras or deep impressions naturally arise through a transition phase between inactive and active. Those samskaras also naturally return from the active phase to the inactive. When there is a convergence (anyaya) of the attention with the rising and falling transitions, a high degree of mastery comes. This is an extremely subtle process of samyama . 
The impressions which normally arise are made to disappear by the appearance of suppressive efforts, which in turn create new mental modifications. The moment of conjunction of mind and new modifications is nirodha parinama. Study of the silent moments between rising and restraining subliminal impressions is the transformation of consciousness towards restraint (nirodhaparinamah). 
When the vision of the lower samadhi is suppressed by an act of conscious control, so that there are no longer any thoughts or visions in the mind, that is the achievement of control of the thought-waves of the mind. The mind is capable of having two states based on two distinct tendencies. These are distraction and attention. At any one moment, however, only one state prevails, and this state influences the individual's behavior, attitudes, and expressions. That high level of mastery called nirodhah-parinamah occurs in the moment when there is a convergence of the rising tendency of deep impressions, the subsiding tendency, and the attention of the mind field itself. Vritti' means literally a 'whirlpool'. It is a thought-wave in the lake of Chitta. Modification of the mind is known as 'Parinama.' Why do Vrittis arise from the Chitta? Because of the Samskaras or Vasanas. If you annihilate all Vasanas or desires, all Vrittis will subside by themselves. If all the Vrittis subside, the mind becomes calm, serene and silent. Then alone you will enjoy peace and bliss. Therefore all happiness lies within. You will have to get it through control of mind and not by CHOPPING OFF YOUR OWN BALLS for semen retention.  Manas is Sankalpa-vikalpatmaka (willing and doubting).  It thinks: whether to go to a place or not; whether to do this or not; whether this is good or bad. The mind is of doubting nature. It is the Buddhi or the light that determines one way or other. Buddhi is Nischayatmaka. It is the determining faculty. The mind, intellect and egoism are various process in the mind-stuff. Ahamkara is the self-asserting principle. It does the function of Abhimana. It creates Mamata or mineness.  EGO is the root cause for all human sufferings. All Vrittis hang on this one Vritti, Aham Vritti.  It is the root cause for human ignorance. Nirodha. It means restraint or suppression. By suppressing the modifications of the mind-stuff or restraining of the thought-waves, a man obtains Yoga. Chitta Vritti Nirodha is the path of Raja Yoga. Suppression of thought waves is easily said. But it is very difficult indeed to practice




3.10 --- tasya prashantavahita sanskarat


The restraint of rising impressions brings about an undisturbed flow of tranquillity.


By maintaining perfect awareness in the intervals between rising and restraining impressions, steadiness becomes effortless and natural. Then the stream of tranquillity flows without any ripples in consciousness.By adept, repeated efforts, consciousness is transformed, cultured, refined and polished. It produces freedom from all forms of fluctuations, so that undisturbed peace can flow. As each drop of water aids to form a lake, so one must continue to prolong each tranquil pause between rising and restraining impressions. An expert of abhyasa and vairagya keeps himself steady, so that calmness can flow uninterruptedly. Thus he released from all previous impressions of consciousness.
The words used by Patanjali for the state of tranquillity constitute atia prasadanam, adhyatma prasadanam, svarasa vahini and ananla samapattih. When agitated, consciousness is brought to an undisturbed state; it is citta prasadanam (favourable disposition of citta). When sorrows are subdued, it is svarasa vahini (flow of the soul's fragrance). When exertion in search of the soul ceases, it is ananla samapattih (assuming the original and eternal form). Expertise in meditation is adhyatma prasadanam (manifestation of the light of the soul). All convey a similar meaning - that the seeker and the sought are one; that the seeker is the seer. That high level of mastery called nirodhah-parinamah occurs in the moment of transition when there is a convergence of the rising tendency of deep impressions, the subsiding tendency, and the attention of the mind field itself. The steady flow of this state (nirodhah-parinamah) continues by the creation of deep impressions (samskaras) from doing the practice. Nirodha parinama is an advanced stage in a yogi's spiritual journey. In this stage, the mind is liberated and no longer influenced by thought-waves, or citta vritti. The state of nirodha parinama is considered to be a transformational state because as the citta vritti cease, the mind is freed to connect with the moment as it appears. Reaching a state of nirodha parinama  takeS a lot of practice and concerted, continual effort. It requires the yogi to have the power to command and restrain their own mind. When they are in this state, the yogi can immediately recognize any samskaras that accumulate and be in control. The flow of nirodha parinama becomes steady through habit. The restraint of rising impressions brings about an undisturbed flow of tranquility. When this suppression of thought-waves becomes continuous, the mind's flow is calm. By constant and uninterrupted practice the mind can remain in a state of attention for a long time. The steady flow of this state (nirodhah-parinamah) continues by the creation of deep impressions (samskaras) from doing the practice. Nirodha parinama bringS about a free flow of peace, tranquility and spontaneous freeing of the mind, unencumbered by thought waves.  Nirodha parinama is the first state of the three parinamas, or great transformations, which together bring the complete liberation of the mind




3.11 --- sarvarthataikagratayoh kshayodayau chittasya samadhiparinamah

The weakening of dissipated attention and the rise of one-pointed attention in the citta is the transformation towards samadhi.


Consciousness wavers between multi-faceted and one-pointed attention. When one-pointed attention is established, multi-faceted attention disappears; when one-pointed attention fades, consciousness is scattered. Observing these alternations and learning to hold unwaveringly to single-pointed attention is the second phase of the transformation - samadhi parinama. Citta has two properties - dispersiveness (sarvarthata citta) and one-pointedness (ekagrata citta), with which it can direct its attention externally or internally. It can unite these two powers into one, to move towards spiritual absorption. Citta assumes the form of any object seen, observed or thought of. It can spread itself as much as it wishes to. When it spreads, it is multi-faceted; when it remains steadily focused, it is one-pointed. When it is scattered, distraction and restlessness sets in. This restlessness can be curbed, but nothing which exists can be destroyed; it can only be transformed, made to disappear or fade by thoughtful attention, enabling the stream of conscious restfulness to flow unwaveringly. In this manner, consciousness is influenced by its own action. It forms the habit of absorbing in a single thought, which prepares one for spiritual absorption. This type of attention, samadhi parinama, stabilises the state of restfulness. In nirodha parinama, the issuing of thought-waves is restrained and quietened. In samadhi parinama, the intervals between the emergence and the restraint of thoughts and vice versa are studied. From this study issues a stillness which leads to silence. One should know that stillness is rigidity and silence is passive and meditative. In the state of silence, the fragrance of the soul emerges as the centre of attention. This is ekagrata paririama. The mind alternates between the possibility of intense concentration and a state where alternative objects can attract attention.
The mastery called samadhi-parinamah is the transition whereby the tendency to all-pointedness subsides, while the tendency to one-pointedness arises. The state of all-pointedness refers to the tendency of the mind to be drawn in countless different directions. In the state of samadhi-parinamah being described, this tendency towards all-pointedness subsides. It does not mean that those countless objects themselves go away, as they are not destroyed. What it does mean is that the inclination of the mind towards this stance of all-pointedness subsides. In other words, it is only one thing that is subsiding, and that is the tendency towards the endless diversity presented to the mind. The state of one-pointedness refers to the tendency of the mind to concentrate or focus on a single point. If you observe your own mental functioning, you can easily see both tendencies. The mind tends both to the diversity of all-pointedness, as well as to one -pointedness. We all experience both of these tendencies in daily life. Here in this sutra, it is this one-pointedness that is arising.  Here, in the high state of samadhi-parinamah, there is witnessing of this transition into samadhi, whereby the all-pointedness subsides, and the one-pointedness arises. It is innate nature of the mind to be attentive to all the things at the same time. One-pointedness is also the nature of the same mind. This is the anatomy of the mind. The mind has to be trained and tamed. This weakening of distractive nature of the mind is the sadhana. Strengthening of the force of one pointedness is a prerogative of sadhana. This taming is a skilful art and should never be forceful and sudden. It has to be gradual. This journey from many-pointedness to one-pointedness is the crux of mental transformation. The process has to be handled very delicately and effortlessly. That is the real mastery over the mind. We are aware of many things, since awareness from one thought/object shifts to another thought/object. But at a single given moment and time the awareness is of only one thought/object. But the shifting is so fast that it appears that the mind is unbridled and disperse. This fastness has to be replaced with slowness and gradually let not the awareness shift from the single object. Finally, the innate unmanifested quality to shift will be eliminated. This subtle transformation is termed as Samadhi Parinama.  Nirodha Parinama is the awareness of the interval between two thoughts and Samadhi Parinama is the awareness of the quietitude. Cultivating one-pointedness infers holding the mind on a single object and vise versa. There are various types of transformations, such as nirodha parinama, samadhi parinama, ekagrata parinama, dharma parinama, lakshana parinama and avastha parinama. These are the terms used by Patanjali to indicate the types or kinds of transformation which the mind passes through in its processes of concentration, meditation and samadhi – which is samyama.




3.12 --- tatah punah shantoditau tulyapratyayau chittasyaikagrataparinamah


When rising and falling thought processes are in balance, one-pointed consciousness comes forth. 


Maintenance of awarenesss with keen intensity from one-pointed attention to no-pointed attentiveness is ekagrata parinama. Even in this focus on the property of citta alone, the sensitivity of attention may be intense or light. To preserve a steady, uninterrupted flow and intensity of attention in citta is the third phase of transformation. Occasionally, consciousness is thoughtfully silent, but then it suddenly spirts out into vivacious activity. In a split second, this activity may be controlled and balance regained. This control needs effort, and effort calls for time. By skillful practice, the depth of silence, which at first appears only in fleets, is made to interpenetrate and fill the entire citta. Then the feeling of time disappears. Past and future are reabsorbed into the timeless. Mind and time are interdependent. As the moments of the mind come to an end, so does time. Citta and the seer (atman) are the two sharp edges of a blade. In one-pointed attention (ekagrata samskara) the energies of the seeker and the seer become one. When the state of restraint is reached (nirodha samskara), glimpses of silence are nurtured and fill the consciousness (samadhi samskara). Then the third phase of ekagrata samskara should be practised. Here, the consciousness which was dependent on external objects moves inwards to infuse the seedless seat of the soul. In. 3/9-12 Patanjali explains the three levels of transformation of consciousness in sequential order - nirodha, samadhi and finally ekagrata.  Ekagrata, as explained earlier, has two meanings. One is concentration on a given object - at this external level it bears the same meaning as dharana. The other is 'one without a second' - i.e., the soul. This level of transformation of consciousness is the highest. Patanjali thus states his meaning as - ekagrata parinama is the final phase of the transformation in which consciousness is uplifted to the level of the soul, and is one with it. The mastery called ekagrata-parinamah is the transition whereby the same one-pointedness arises and subsides sequentially. Rising and subsiding of the same one-pointedness: In the last sutra, it was described that all-pointedness subsided and one-pointedness arose. Now, in this sutra, the subject is where that one-pointedness subsides, only to arise again. The many-pointedness is not there, only the cycling and recycling of the one-pointedness. It is this transition that is being witnessed. Three transitions: Thus, we are referring to three forms of transition in sutras 3.9-3.12. The first one related to the transition of the mastery of thought patterns itself. The second related to the transitioning rise of one-pointedness of mind, along with the subsiding of the many-pointedness. The third (in the current sutra) relates to the transition of the repeated rising and subsiding of the same one-pointedness. Mastery over transitions: Once again, this witnessing and mastery over transitions themselves gives mastery over the underlying thought patterns and processes themselves. In other words, master the transitions, and you master the thought process; master the thought process, and you can go beyond, ultimately to experience the center of consciousness .
When the subsiding past and rising present images are identical, there is ekagrata parinama (one-pointedness). The mind becomes one-pointed when similar thought-waves arise in succession without any gaps between them. The mind reaches a stage where the link with the object is consistent and continuous. The distractions cease to appear. The mastery called ekagrata-parinamah is the transition whereby the same one-pointedness arises and subsides sequentially. The various likes and dislikes in the mind are vrittis. It is the urge that is felt inside the mind itself which propels it towards something outside, whether it is a physical object or a conceptual notion. This urge within is an impediment. An ekagrata vritti is not normally present in the mind. It has to be brought about; it has to be introduced by effort. This is samyama; this is, precisely, yoga. The ekagrata vritti is the healthful tendency of the mind, the power with which it keeps the organism of the mind intact and prevents any kind of depletion of energy. The integrating force, which is the ekagrata vritti, will not allow the leaking out of mental energy in respect of objects outside. It blocks all the passages of sense and the tendency of the mind. But these tendencies are also powerful enough, so they try to break through the fortress which has been built by the ekagrata vritti, and then, somehow or other, try to get out, just as prisoners can run out of the jail in spite of the great guard that is kept around them. Ekagrata   is intent pursuit of one object, close and undisturbed attention.Yoga emphasises regular practice (Abhyasa) meditation and self-imposed discipline to acquire ekagrata. Dharana converges on a particular concept or object. In the state of ekagrata there is clarity and right direction: yoga begins with ekagrata and culminates in nirodha, a consciousness free of movement. Dharana gives the ability to see one’s own mind, one starts looking inwards deeply. If ekagrata is lost the full power of intention to achieve goals to be achieved is lost. Intentions afflicted by doubts, fears and reactive thoughts break and diffuse the energy of intentions.The mind which is the cause of Sankalpa ('notion')-Vikalpa ('alternative') must be controlled, it must be bound. Ekagrata assists in keeping one’s own mind bound and still.




3.13 --- etena bhootendriyeshu dharmalakshanavastha parinama vyakhyatah


Through these three phases, cultured consciousness is transformed from its potential state (dharma) towards further refinement (laksana) and the pinnacle of refinement (avastha). In this way, the transformation of elements, senses and mind takes place.

The three stages of transformation elucidated in III.9-12 affect the entire being - organs, senses, body and mind, and bring about a stable, sound state of consciousness. Both purusa and prakrti are eternal. Purusa remains perpetually changeless. Prakrti goes on ceaselessly changing, due to the interaction between its own gunas of sattva, rajas and tamas. Earth, water, fire, air and ether; their counterparts smell, taste, sight, touch and sound; the senses of perception and organs of action; mind, intelligence, consciousness and ego are all parts of nature. Ego, consciousness and intelligence are sensitive and elusive. They pile up experiences of objects perceived through the senses of perception, organs of action and mind. These experiences differ according to their relation to circumstances. In this way, consciousness is throttled by the qualities of nature. It is also linked with time, because it fluctuates with thoughts of past, present and future. By disciplined study and effort, experiences are observed to move qualitatively towards the best. Through study one realises that consciousness has four dispositions or attributes. The first, when avidya is predominant, is its wandering nature - vyutthana samskara. The dawning power of discrimination leads to the second tendency - restraint, nirodha samskara, dharma pannama. The effect of restraint is the flow of tranquillity (prasanta vahita samskara), experienced between vyutthana and nirodha samskaras. This gives rise to the third tendency - laksana parinama. The effort to lengthen this silent intermission brings the sadhaka to the pinnacle of emancipation (avastha pannama) - the fourth or final attribute of consciousness. When consciousness loses all these tendencies and becomes contemplative, it rests in the seer. This affects the behavioural patterns in the body, senses and mind, which also remain peaceful. Consciousness becomes pensive. This wholly peaceful state is ekagrata parinama.  By thoughtful action, consciousness traces the source of its attributes, moves towards it, and is dissolves in that. At that moment, body, senses and mind are devoid of evolution and dissolution, of birth and death. This is viveka khyati. The sadhaka transforms himself to an exhilarated state (dharma parinama), develops awareness of perfection (laksana parinama) and maintains himself, without losing the acquired perfection (avastha parinama). Dharma parinama is the knowledge of prakrti and purusa; laksana parinama is the way one makes use of them; and avastha parinama is steadily maintaining them, once they have been purified of trial and error, in the established state. In this process the elements, organs of action, senses of perception and mind are transformed; purusa is recognised and understood. All these transformations are stabilised, and the changing states in body, mind and ego come to a conclusion, enabling the sadhaka to rest in the eternal undying purusa. The search terminates and dichotomy between the seeker and the sought ends as the seer realises that he alone was the seeker, seeking his own form - svarupa. From now on, he drinks the nectar of his own self-generating pure fragrance. These three phases of conscious transformation culminate in tranquillity. Awareness flows peacefully, and virtue arises as dharma parinama. This is the true character of intelligence and consciousness. Now, the sadhaka is highly sophisticated and civilized. This is laksana parinama. Maintaining this qualitative state of conscious progression towards the pinnacle is avastha parinama.
Through these three phases, cultured consciousness is transformed from its potential state (dharma) towards further refinement (laksana) and the zenith of refinement (avastha). In this way, the transformation of elements, senses an mind takes place. In this state, it passes beyond the three kinds of changes which take place in subtle or gross matter, and in the organs: change of form, change of time and change of condition. As it has been established that the mind has different states [corresponding to which there arose different attitudes, possibilities, and behavior patterns in the individual] it can also be said that such changes can occur in all the objects of perception and in the senses. These changes can be at different levels and influenced by external forces such as time or our intelligence. Parinama is a Sanskrit term describing transformation or change, on both a philosophical and practical level. Patanjali outlined six kinds of parinama: nirodha parinama (the suppression of the vrittis), samadhi parinama (development of samadhi), ekagrata parinama (one-pointed transformation), dharma parinama (transformation of appearance), lakshana (transformation of character) and avastha parinama (transformation of condition). Both Samkhya and yoga schools of Hinduism believe that everything is a projection of something that has already been present or hidden. That is also why these schools of thought believe that the world has materialized out of the world that existed in a hidden way before. This is called the "Parinama Vada," the transformation theory. With reference to the Antahkarana, the Dharma that operates at the present moment is Dharma Parinama. With reference to what has passed and to that which is yet to come, it is Lakshana Parinama. If the present Dharma increases or decreases, it is Avastha Parinama. Thus the three kinds of Parinama occur in the Bhutas and Indriyas also. The mind assumes various forms. This is one kind of Parinama with reference to form. When the change becomes manifest in relation to some time, past, present or future, it is called Lakshana Parinama. When after this the particular property ripens into maturity or decay, it is called Avastha Parinama. The mind passes into various states. It is also Avastha Parinama.




3.14 --- shantoditavyapadeshyadharmanupati dharmi


The substratum is that which continues to exist and maintain its characteristic quality in all states, whether manifest, latent, or subdued.


The integral characteristic quality of nature (mula-prakrti) has three properties - pacified or calmed (santa), manifested (udita) or latent (avyapadesa). They appear indistinctly or clearly, according to one's intellectual development. The substratum of nature remains the same for all time, though transformations take place. The moulding of consciousness takes place owing to the changes in the gunas of nature. Patanjali explains the three phases of consciousness as rising, being restrained and the pauses between the two. In III.10, he describes these pauses as tranquil consciousness. If these pauses are prolonged, all pointedness and one-pointedness meet, and there is no room for rising or subsiding of thoughts Sutra 12 explains that maintaining these quiet moments gives rise to a balanced state of consciousness, which is described in III. 13 as a cultured and harmonious state. Rising and restraining thoughts are the inclinations (dharma) of the citta, and the tranquil state is its characteristic quality (dharmi). The rising citta is felt in the sensory body. Citta then appears at the external level as bahirahga citta. Watching the movement of rising thoughts is an external or bahirahga sadhana. The delicate restraint of rising thoughts moves citta inwards from the peripheral body - this is inner or antarahga sadhana. Stabilising the tranquillity that takes place in the intervals is innermost or antaratma sadhana - that state is considered to be an auspicious moment of consciousness. It is like re-discovering the dust, which existed before the pot. Consciousness has three phases - external, internal and innermost. As one traces and retraces these, their relevance can be noticed to an individual's practices of asana, pranayama and meditation, in which consciousness moves from the skin inwards, and each cell and fibre is infused with the tranquillity of the seer. 
Today, everyone is aware of constant 'stress and strain' in life. These aspects of consciousness which confuses life are by no means new to mankind. Patanjali's word vyutthana, used to designate the 'emergence of rising thought', is equivalent to the appearance of 'stress'. Nirodha, 'restraint of rising thought' is equivalent to the 'strain' of trying to control that stress. Striking the balance between the two is called 'relaxation' (santi citta). Restraining of rising thought is against the current (pratipaksa). Hence restraint is strain. A person who has undergone childhood is santa, because that childhood stage has passed and is over. As one stands at the threshold of youth, he is in the present or udita state. In course of time, one moves towards old age, which is yet to come - this is avyapadesya, old age which is still in an unmanifested form and indistinct. But the person remains the same through all these changes. That unchanging person is dharmi. Likewise, milk is the property which separates into curds and whey, or changes into butter. It is the same with dust, which is formed into clay to make a jar. The dust stands for the past, the clay for the present, the jar for the future. Thus every change from the source move in time as past, present and future. In II.18, the properties of nature are explained as luminosity (prakasa), vibrancy (kriya) and inertia (sthithi). By the use of these qualities, one may be entangled in a mixture of pleasure and pain, or go beyond them to unalloyed bliss.  
The properties of nature exist for the purpose of one's evolution and involution. Consciousness, being a part of nature, is bound by the spokes of the wheel of time. If an aspirer sows the right seed through knowledge and discrimination (viveka) and develops consciousness, he reaps the fruit of self-realisation through ekagrata. He becomes the force which severalises between the hidden properties and the transformations of nature. He recognises his true, pure state of existence which is changeless and virtuous. This is the fruit earned through the astute effort of sadhana. The import of this sutra can be used to practical advantage while practising asana, pranayama or meditation. If one observes the various scattered cells dust lying latent in the body, and charge them so that they adhere (lump of clay), one can feel the inner unity and transform body, breath and consciousness into designs in the form of different asanas and pranayamas, as the potter moulds his clay into a variety of shapes. 
In asana, if the energy of the body is reconciled to a 'point zero', while in a state of tension, one accomplishes exactness. The same can be applied to the intake of breath, its distribution or discharge in pranayama, and in meditation. The combining of single-pointed attention with all-pointed attention at the core of one's being is the essence of this sutra. 'Point zero' designates the point of balance and harmony at which one can unlock and liberate the problematic confusion of matter and emotion. It also expresses the importance of finding the exact centre of the meeting points of vertical extension and horizontal expansion in body, breath and consciousness. It is the substratum (Prakriti) that by nature goes through latent, uprising and unmanifested phases. The substrata is that which continues to exist and maintain its characteristic quality in all states, whether manifest, latent, or subdued. A compound object has attributes and is subject to change, either past, present or yet to be manifested. 
A substance contains all its characteristics and, depending on the particular form it takes, those characteristics conforming to that form will be apparent. But whatever the form, whatever the characteristics exhibited, there exists a base that comprises all characteristics. Some have appeared in the past, some are currently apparent, and others may reveal themselves in the future.There is an unmanifest, indescribable substratum or existence that is common or contained within all of the other forms or qualities.There is an unmanifest, indescribable substratum or existence that is common or contained within all of the other forms or qualities. Find the substratum: The point of witnessing all of those subtle processes is to find that substratum, the object underneath, that is common to all, is continuously existent within them all, and unchanging in any of them. This is a further refinement of the process described throughout Yoga of witnessing and setting aside that which is not the eternal, indivisible reality of our true nature that we are seeking. After everything else is eliminated, we experience the true Self .




3.15 --- kramanyatvan parinamanyatve hetuh


Successive sequential changes bring about the distinctive changes in the consciousness.


Differences in changes in consciousness are caused by the changing order of sequences in the method of practice. According to the sequence of practice, distinct transformations take place. The earthenware pot instance and look at the clay dust as the first principle of evolution, will help one understand the property (dharma) contained in it, the lump of pliable clay which embodies the qualitative mark (laksana), and the jar which culminates the process and which represents the evolved state (avastha). Only by following a certain sequence of actions can one turn earth into pottery. This is harmonious and organic growth. In yogic practice a regular sequence must also be followed. The sadkaka first acquires restraint in consciousness (nirodha parinama) in order to experience tranquillity (samadhi parinama). Then he proceeds towards the 'one without a second', the seer (ekagrata parinama). Only then does he become a fulfilled yogi (krtarthan). Though consciousness may be considered partially to exist outside time, the work needed to transform that consciousness definitely exists inside the framework of time. It may well be that there is an evolutionary 'tilt' to the cosmos by which all things incline to evolve for the better in the long run. But one cannot count on that, and so some amount of individual effort is necessary, especially as the world itself, the only known theatre of action for this evolutionary drama, is now in danger from man's excesses of pollution, greed and war. Such was not the case in Patanjali's times, yet he saw fit to furnish the future with an exact evolutionary map, so that one's advance might be orderly and expeditious. There is a logic to the involutionary spiritual journey, just as there is in the growth of a plant from seed, to stem, to bud, to flower, to fruit. The original, pure consciousness which one traces through Patanjali's method is the seed of transformation in oneself.  One's own self is the maker of one's own spiritual destiny. The importance of structure and sequence can be shown in the instance of language-learning. If one starts out to learn a language without structured tuition, one may or may not learn it. It is a 'hit or miss' process. But if one seeks to learn in a structured way, there is a definite order of procedure. One starts with the present tense of the verbs 'to be' and 'to have' and certain basic nouns and prepositions. To start with complex grammatical forms would be idiotic and self-defeating. The structure of evolution and progress in all things has its own inner logic and harmony. This is sequence, or krama. Change in the sequence of the characteristics is the cause for the different appearances of results, consequences, or effects. There is a natural flow or transformation in all levels of nature, whether in gross or subtle planes of reality. These transitions are the foundations of the principle of cause yielding effect. Some of these are known at the surface level by all of us. The subtler transitions are known to the Yogis. One of the foundation principles of Yoga is non-attachment .  This is a process that evolves in stages, and that here, in this section we are talking about extremely subtle processes. Though the processes are subtle, the principles are the same. You witness, notice an underlying reality, and let go of the more surface attachment. A particular form comes from the sequence of states: Imagine that you are able to meditate so quietly that you recognize that all of the objects of your attachment were simply a result of a change of sequence in states. For example, clay turns into pot (while remaining clay), and then, eventually turns back into clay. So it is with all of the objects, whether objects in the external world, or object in the mind. It is all a matter of changing form, or the sequence in which those forms are seen. Gradually, the unchanging truth is revealed, underneath all of the apparent change in successions of transformations of that uniform oneness. By changing the order or sequence of change, characteristics that are of one pattern can be modified to a different pattern.  Change in the sequence of the characteristics is the cause for the different appearances of results, consequences, or effects.


THIS POST IS NOW CONTINUED TO PART 63 , BELOW-








CAPT AJIT VADAKAYIL
..

157 comments:

  1. http://timesofindia.indiatimes.com/india/Supreme-Court-favours-life-imprisonment-for-milk-adulteration/articleshow/53560913.cms

    MILK ADULTERATION WAS DONE BY POLITICIANS WHO SPONSORED THE WHITE REVOLUTION . .

    THESE DESH DROHIS TOOK AWAY OUR PRICELESS VEDIC HUMPED COWS WHICH GIVE NUTRITIOUSA2 MILK AND SWITCHED THEM WITH HUMPLESS WESTERN COWS WHO GIVE US LARGE QUANTITIES OF A1 TOXIC MILK . . .

    SO CUT THE C R A P . . .

    http://ajitvadakayil.blogspot.in/2013/07/nutritious-a1-milk-of-vedic-cows-with.html

    ReplyDelete
    Replies
    1. Today first time in my life had A2 milk ánd it was awesome ...... Wow

      I feel cheated for so many years

      Delete
    2. Can I import any humped cow in U.S. .......I know I feel cursed living with hilly billy yanks

      Delete
    3. Parminder - look for craigslist or other websites for "brahman" cow milk. It is a humped cow. Also, some farmers get their cows (Guernsey , for example) certified as A2, if you trust, you can try that.

      Delete
    4. A CERTIFICATE CANNOT CREATE A NON EXISTANT HUMP ON A COW

      Delete
  2. http://agniveer.com/babri-mosque-homosexual-lust-symbol-babur/

    ReplyDelete
    Replies
    1. ghazni was so addicted to receiving anal sex that his slave with a big DONG ruled over him.

      http://ajitvadakayil.blogspot.in/2013/11/the-sack-of-somnath-temple-by-mahmud-of.html

      Delete
  3. Perception moulders at work , I have not seen a single instance where Times Now supported beef ban,cow slaughter ban , whenever this topic arouses Times Now suddenly becomes ultra Constitution thumper and secular , We know who is funding Times Group , they can't fool people singing in the tunes of central party only when it's good for them , we don't care about any party ,we only care about Dharma

    ReplyDelete
    Replies
    1. That's my observation on Arnab also. He is very selective and keeps his feet on both the boats. He is more dangerous that way. He intentionally provided an escape route to Old pal Barkha so that the new controversy can drown the Hafiz Saeed's comment on Barkha. Later, Arnab did not utter a single comment on Barkha's outbirst.

      Delete
    2. he is only fair in debates concerning pakistan and kashmir.On rest of the topic he is same as barkha,rajdeep etc..He wants just TRP by projecting himself Pro-nationalist on certain topic and secular on other..

      He is a foe who turns himself as friend,deshbhakt on Pakistan debate so that he can stablish ETHOS between common viewers n him.. he can then use this established ETHOS to do perception MOulding on rest of the topic like Cow, mensurating women entering temple, dalit etc stuff..

      he is more dangerous than Barkha,rajdeep,sagarika..PLEASE READ CAPTAIN'S BLOG ON "ETHOS,PATHOS,LOGOS.."

      Delete
  4. Hello sir tell me about dattatreya is fake are not

    ReplyDelete
    Replies
    1. Get your answer instantly. Punch in to google dattatreya fake vadakayil.

      Delete
  5. Captain,

    Sachin Tendulkar is now GOD- The Saviour !!

    https://twitter.com/sachin_rt/status/761636166953213952

    Pranam.

    ReplyDelete
    Replies
    1. see sachin's mug --

      he thinks he is god, because he has replaced goddess laxmi with his ugly face -on akshaya tritiya coins

      http://asianetindia.com/wp-content/uploads/2013/05/sachin.jpg

      Delete
    2. Captainji....now a day silver coins has started coming with a king edward face and Elizabeth face on the back of the coin...it started from the last year

      Why it suddenly started

      Delete
  6. Captain Sir,

    I have been told by astrologer to wear blue sapphire to ward the effects of malefic shani ? Do gemstones work ?

    thanks

    ReplyDelete
  7. https://youtu.be/ghec8deupQ8
    Hi Captain is it a bad thing to research on gravitational waves? What will they achieve by doing it and what is 5th dimension?

    ReplyDelete
  8. I'm sure even this gravitational wave theory they stole from our Vedas and credited Einstein for it

    ReplyDelete
  9. Hi captain
    http://www.indiatimes.com/news/india/world-bank-says-india-is-no-more-in-developing-country-category-instead-they-have-something-much-worse-255987.html

    ReplyDelete
    Replies
    1. WE HAVE STOPPED CARING FOR SUCH SLANTED NEWS

      Delete
  10. Respected Captain Vadakayil
    http://www.speakingtree.in/slideshow/lord-shiva-sister-devi-asavari-story-and-facts?utm_source=TOInewHP_TILwidget&utm_medium=ABtest&utm_campaign=TOInewHP
    Now speaking tree is peddling huge lies about Devi Asavari, who is supposed to be the sister of Lord Shiva. This is pure unadulterated bullshit! Please nip this in the bud.
    Regards

    ReplyDelete
    Replies
    1. THESE FAKE STORIES ABOUT ASAVARI ARE CREATED BY THE DROHIS OF THE LITERARY FESTS AND JNU COMMIE PROFESSORS.

      SHIVA IS A COSMIC ALLEGORY

      Delete
    2. No wonder,speaking tree is from Times Internet = TIMES GROUP = Bennet Coleman & Co Ltd(BCCL)

      Delete
  11. Gora gand controlled tissue paper wants kids to eat non veg in Shravan

    Fish, chicken or meat: What's better for your kid?

    http://timesofindia.indiatimes.com/life-style/health-fitness/health-news/Fish-chicken-or-meat-Whats-better-for-your-kid/articleshow/53553852.cms?utm_source=TOInewHP_TILwidget&utm_medium=ABtest&utm_campaign=TOInewHP

    ReplyDelete
  12. Then what are you all waiting for? Whichever website you find lies...correct them with the fact. Paste websites like Ajit Vadakayil blog, indiafacts.org etc in the comments everywhere. Let ignorant Hindus know the glory of Hinduism through captain's blog and conspiracy against Hinduism through websites like Indiafacts.org .... both of them are working complementary in exposing the truth of present era.

    तत् त्वम् पूषन् अपावृणु -- Lord remove the covering so that the seeker may see the truth.

    Awaken people and make them aware. Mass awakening is the solution of everything gentlemen. I discuss these things everywhere I go. Make it a mass movement -- The awakening of the intellect.

    Warm Regards
    Prithvi Singh

    ReplyDelete
  13. Dear Capt Ajit Sir,

    It's high time that you rip Hillary Clinton and bring her to her knees for these recent 2 killings of anti-Clinton Activists...http://www.renegadetribune.com/two-prominent-anti-clinton-activists-found-dead-two-days-mainstream-media-blackout/

    ReplyDelete
  14. Captain why you have reduced staying time on blogs earlier u waited for some to write new article why so much hurry?

    ReplyDelete
  15. Captain Modi's townhall speech only proves that he too have become 100% secular. Disappointing

    ReplyDelete
  16. Hi Ajit,

    Can the aluminum toxicity in the body be reduced by practicing pranayama on a regular basis? Further, does a visit to a sauna help in lowering the aluminum levels, as it is popularly known that sauna helps in releasing toxic metals from the human body.

    Kindly advice.

    Aneesh

    ReplyDelete
  17. Tulsidas wrote in Awadhi language about the twin sons of Rama, ( Luv/ Kush ) who were born in the forest after Rama kicked his pregnant wife Sita out. We Indians never heard this bullshit story till the white invader came to India.

    Luv/ Kush captures the white ashwamedha horse of Rama. This bullshit episode also never happened.

    http://ajitvadakayil.blogspot.in/2014/09/ashwamedha-yagam-bloodless-sacrifice.html

    Jew Rothschild created Awadhi language ( from a dialect of Nepal ) to inject poison into Hinduism.

    Same was Jew Rothschild created the Urdu language to divide and rule.

    Jew Rothschild used the FAKE and backdated Bhakti movement, using the FAKE and backdated DASAs to shatter the bed rock Sanatana Dharma ( Laws of Karma/ Moksha ).

    He was unsuccessful though.

    It does NOT matter if you sing bhajans in praise of the lord throughout the day, take a dip hundreD times in Kashi—you cannot escape the laws of Karma. Nobody can raise the kundalini unless the Karmic baggage is worked out and is approaching zero.

    The Guru Granth Sahib is packed with DASA verses.

    http://ajitvadakayil.blogspot.in/2013/07/unknown-history-of-sikhs-and-sikhism.html

    ReplyDelete
  18. Dear Sir,

    This is major development with good analysis.
    India Remains Committed to the Concept of a Multi-Polar World
    US Fails to Drive a Wedge Between India and Its BRICS Partners
    http://sputniknews.com/politics/20160806/1044003823/us-india-china-russia-brics.html

    Best Wishes,

    ReplyDelete
    Replies
    1. BOTH INDIA AND CHINA REALISE THAT THE WHITE MAN IS LOATHE TO BE LORDED OVER BY A YELLOW/ BROWN SKINNED MAN

      BOTH INDIA AND CHINA KNOW THAT THE WHITE MAN ( AS IN THE PAST ) WOULD LOVE THE YELLOW AND BROWN SKINS TO FIGHT EACH OTHER AND DESTROY EACH OTHER

      INDIA AND CHINA ARE NOT STUPID !

      Delete
  19. hi captain !

    happy nagpanchami.I have a doubt over a practise in this festival.Do snake drink milk ? can they digest milk?

    ReplyDelete
    Replies
    1. https://www.youtube.com/watch?v=14kfYTo3jK4

      Delete
  20. Pranam Captain, JAI MATA DEE
    I have been following your blog for a long time. I must say you have opened my eyes. I just wanted to visit Mookambika and Chottanikkara Temple. Also I wanted to ask where can I meet a good Namboodiri astrologer.

    ReplyDelete
  21. Hi Captain, I have been reading your blogs for a long time. I feel I should visit Kerala and seek blessings from Devi Mookambika and Chottanikkara temple. Bhagavan Adi Shankaracharya and Namboodiri community have done a magnanimous job by preserving the Vedic Shiva Shakti worship. Zionist Jews today don't know that their ancestors used to worship the divine couple of Shiva and Shakti. Star of David/Hexagram/Shatkona is the divine Shree Chakra which symbolizes the union of Shiva and Shakti. Netanyahu and other Zionists will never agree that Queen Sheba was from Kerala.

    I wanted to ask you whether or not the Japanese are the descendents of ancient Israelites?

    ReplyDelete
  22. Bhaskar MehraAugust 7, 2016 at 10:55 AM
    Dear Ajit,
    Wtf are you talking about? Your own son studied at a so called 'opium funded' university. Do you even know how much grant the Rockefeller family donates to Cornell every year? True, Barkha Dutt is an imbecile journalist but her education hardly has anything to do with it. Its her character. If today you were in the rat race of getting into college admissions, only then you would've realised what an education from Columbia implies. They would've rejected your application without even reading it. Don't go on blaming people for their education if they worked hard for it in the past. That just makes you an envious and classless tumour. She's bad because she's an ass hole, not because she got some kind wrong teaching ethics from columbia. Stop being such a hypocrite. Your own son studied on drug money. Smh

    Regards

    ReplyDelete
    Replies

    ###############

    Capt. Ajit Vadakayil
    August 7, 2016 at 2:42 PM

    CORNELL DOES NOT ADMIT ROTHSCHILD SPONSORED INDIAN DESH DROHIS - LIKE COLUMBIA UNIVERSITY

    THERE IS A DIFFERENCE BETWEEN FIGHTING YOU WAY IN -- AND BEING SPONSORED BY BIG BROTHER FOR A POLITICAL AGENDA.

    WHEN AN INDIAN FIGHTS HIS WAY INTO A CEREBRAL STREAM LIKE COMPUTER SCIENCE, AND DOES WELL, HE GETS THE FEELING THAT HE IS TOP INTELLECTUAL NOTCH.

    BR AMBEDKAR OR DIG VIJAY SINGHs SON OR BARKHA DUTT HARDLY HAD TO FIGHT THEIR WAY INTO COLUMBIA UNIVERSITY.

    http://ajitvadakayil.blogspot.in/2010/11/my-son-at-cornell-university-capt-ajit_25.html

    ReplyDelete
  23. http://timesofindia.indiatimes.com/india/Kerala-Congress-Mani-quits-United-Democratic-Front-coalition/articleshow/53584460.cms

    INSIGNIFICANT PARTIES WRANGLE SEAT SHARING

    AFTER WINNING ELECTIONS BY HANGING ON TO THE LANGOTS OF THE MAIN PARTY - THESE INSIGNIFICANT LOCAL PARTIES LOOK FOR GREENER PASTURES

    CAPTAIN VIJAYAKANTH OF TAMIL NADU HAS LEARNT HIS LESSON THE HARD WAY

    ReplyDelete
  24. http://timesofindia.indiatimes.com/india/Indian-journalists-barred-even-from-standing-outside-gates-of-SAARC-meet-venue-in-Pak/articleshow/53583540.cms

    SO ARE WE BABES IN THE WOODS ?

    BAN PAKISTAN AS A FUTURE VENUE

    INDIA MUST DECLARE THIS NOW !

    ReplyDelete
  25. Capt., Isn't Janmejaya's Sarpa Satra a fake story? What is the significance of Naag Panchami?

    ReplyDelete
    Replies
    1. http://ajitvadakayil.blogspot.in/2012/07/king-cobra-and-snake-temples-of-kerala.html

      Delete
  26. http://timesofindia.indiatimes.com/videos/sports/other-sports/Watch-Sachin-Tendulkar-meets-Leander-Paes-in-Rio/videoshow/53581279.cms

    SACHIN TENDULKAR REPRESENTS A SPORT PLAYED BY NINE AND A HALF COUNTRIES ON THE PLANET

    CRICKET IS CONTROLLED EVEN TODAY BY ROTHSCHILDS FORCES --JUST LIKE COMMONWEALTH

    ROTHSCHILD USES HIS STOOGE THE BRITISH QUEEN TO CONTROL THE PLANET EVEN TODAY

    http://ajitvadakayil.blogspot.in/2013/04/india-must-quit-commonwealth-capt-ajit.html

    ReplyDelete
  27. ZIONIST JEW DOUBLE AGENT HAFIZ SAEED WANTS URDU TO BE BANNED IN PAKISTAN.

    Urdu has more than 100 million speakers today.

    ROTHSCHILD created the Urdu language and replaced Persian,the official language used by Mughal rulers with Urdu language in 1837.

    R used Khadiboli as the base and threw in some Persian and Arabic words as a hotch pocth—and hey presto R had a new language Urdu,to divide North India from South India.

    Then Rothschild went further to DIVIDE AND RULE. He made his CRYPTO JEW Muslim stooges sponsor Urdu for the Muslim population of India . This effort started in Bihar first and then spread to UP and then all over North India.

    After independence, Pakistan put more Persian words and Afghani Pathan Pashto words in Urdu and made it a Pakistani Urdu.

    Indian madrasas teach Arabic as well as Pakistani Urdu.

    Urdu has been given official language status in UP, Bihar, Telangana (can your believe this ?) and of course Kashmir .

    BEEF EATING BRAHMIN KATJU GET AN ORGASM WHILE LISTENING TO FAALTHU URDU VERSES

    WAH WAH WAH KYA BAATH HAI

    To get a greater Islamic literature audience in India Urdu media uses Devanagari script.

    In Mecca signs and boards are written in Arabic, and Urdu.

    Islamised Urdu is written from right-to left, like Persian alphabet,and Arabic.

    You can see Ghulam Ali using this type of Pakistani Urdu.. with HAJAAR farmaiye , tashrif rakhiye type words. I guess these words give people like Girish Karnad – a HARD ON.

    PAKISTAN IS NOW DOING A URDU PUSH IN INDIA—AND MODI HAS FALLEN PREY TO IT. THEY SAY THIS WILL BRING INDIA AND PAKISTAN CLOSER.

    THE NAKED REALITY IS THAT IT WILL BRING INDIAN MUSLIMS CLOSER EMOTIONALLY TO THE PAKISTANI WATAN-NOT INDIAN WATAN.

    MODI WANTS ONLY ADVISE WHICH SUITS HIM PERSONALLY-- I HEARD HIS LONG SPEECH YESTERDAY

    WHAT ELSE CAN YOU EXPECT FROM A FELLOW WHO SHED TEARS WHILE SAYING "BJP MERI MAA HAI --BOO HOOOOOOO"

    Language creates loyalties.

    In Kerala , the Malayali Muslims do NOT suck up to Islam while abroad in the Gulf . They are level headed and Malayalam is a great binding factor – unlike the Bihari or Bengali.

    R created a SINGLE holy book for the Sikhs and a whole new language for the Indian muslims

    http://ajitvadakayil.blogspot.in/2013/07/unknown-history-of-sikhs-and-sikhism.html

    Planning was done centuries in advance how to create a Islamic buffer on either side of the Himalayas – between Communism and the all weather blue ocean navy.

    IN AN ALL OUT WAR WITH PAKISTAN , THE ENTIRE SUNNI ARAB GCC NATIONS RULED BY CRYPTO JEWS ( CONTROLLED BY R )WILL GIVE THEIR FIGHTER JETS, NAVAL CARRIERS AND SUBMARINES TO PAKISTAN.

    CHARKHA GHUMAAKE !

    Capt ajit vadakayil
    ..

    ReplyDelete
  28. Captain.
    This marriage video for you: https://www.youtube.com/watch?v=qn327Q5EAhc

    ReplyDelete
  29. Captain I am a Deshashta Brahmin and you are spot on about Chitpavan Jew "Brahmins"

    ReplyDelete
    Replies
    1. ALMOST ALL HOMOSEXUALS IN MAHARASHTRA ARE FROM THIS CHITPAVAN JEW NAY BRAHMIN COMMUNITY

      THESE PEOPLE HAVE INVADED RSS.

      Delete
    2. Captain , is it true that these chitpav jews in RSS tried to kill Mohan Bhagwat ?

      Delete
    3. https://www.youtube.com/watch?v=EJabxPmbIbo here is a yesteryear famous celeb from this community

      Delete
  30. Why Women DESTROY NATIONS * / CIVILIZATIONS - and other UNCOMFORTABLE TRUTHS

    https://www.youtube.com/watch?v=UxpVwBzFAkw


    I Do not Know How True this is but really eye opening, Sir do watch this if you have time

    ReplyDelete
    Replies
    1. yes it has been proved time and again through out the history , but can't blame all the women just like we can't blame all the men for these single messiah religions , most of the culprits are barren,unmarried women ,these kind of ego centric woman can't think beyond the scope ,they don't have enough perception to plan for a long shot

      Delete
  31. Black stone shivaling found in Khjuraho's pratapeshwar temple.

    http://www.bhaskar.com/news-mlite/MP-BPL-HMU-khajuraho-temple-discovered-news-hindi-5390331-PHO.html?seq=1

    ReplyDelete
  32. Sir,

    I need your help.

    In my childhood I was in touch with some really nasty friends who were immoral in nature and therefore came in touch with pornography when I was not even a teenager.

    I was also sexually harassed(Though it was not very severe) but as a child I did not understand that.

    I also got involved in the debauchery and degeneration of homosexuality as I thought it was normal but there was no penetration. This can be also because our milkman used to give high doses of estrogen into the cow through injection.

    Now I know I am a straight man but as a Hindu I feel disgusted and repentful of what happened. I know I will taste the result of my Karma.

    Now as adult when I understand things I loath this sick homosexuality and when I see Indians supporting it I feel sad as they do not know what it is.

    But still there is this feeling of guilt.

    What can I do captain? Help me.

    BR

    ReplyDelete
  33. West Bengal want to become Bengal am sure that 10 years down the line they will become Bangladesh and would prove that no matter how much you guys were persecuted during partition or during 1971 you guys would not learn any lesson you would be happy I mean blissfully happy singing while your identity is being screw .I am sure even God can't save you .

    ReplyDelete
    Replies
    1. They are romanticizing with Bengali Sub-nationalism. The idea was played out in 1941-47. The idea was to create a United Bengal comprising WB, B'desh, some part of Bihar and NE. Some leading politicians and intellectuals took active part in that. Shyama Prasad Mukherjee opposed that and to safeguard Hindus, proposed division of Bengal.

      Some Dalits believed the Muslims. One noted such leader was Jogendra Nath Mandal who became first law Minister of Pakistan. He had to flee east Pakistan with his family within 3 years to India.

      Delete
    2. Every Ambedkar vaadi and his supporters should read this resignation letter of Jogendra Nath Mandal one of the founding fathers of Pakistan & side kick of BR Ambedkar ,because of foolish acts of these two people dalits (i hate to use this word) were orphaned and left to suffer in the hands of fanatics in pakistan & bangladesh , these people brought it upon themselves for believing the snakes and betraying their own people

      Resignation letter of Jogendra Nath Mandal

      Delete
    3. i have been researching about the demographics of india with pakistan and bangladesh and i am convinced rothschild planned the partition from the mutiny itself...after looking at google maps satellite images of the indian subcontinent i am convinced pakistan and bangladesh are lying about their population figures [in fact they exaggerated their population from their very first census to inflate muslim population numbers vs hindus/non-muslims]....bangladesh population today is i estimate to be only around 110 million [90 million muslims] with pakistan having 115 million[105 million muslims] vs india which has 1.3 billion with nearly 180 million muslims.....also indonesia is another country that has inflated its population by around 50 million [again to inflate muslim population numbers]

      Delete
  34. Respected Captain Vadakayil
    What is your take on Petrified Forest National park ? Does it have something to do with Yggdrasil?
    Regards

    ReplyDelete
  35. Namaste Sir, yesterday I watched a movie Once Again Ghayal, Starring Sunny Deol.. It seems the story and many events in the movies is about you, your blogs and message that you convey through the blogs.. I just thought of sharing with you

    ReplyDelete
  36. Hi Captain,

    News Link --->>>

    ####################

    "BHARAT NOT BIGGER THAN KHUDA": ALLAHABAD SCHOOL BANS JANA GANA MANA & VANDE MATARAM

    http://www.thequint.com/india/2016/08/07/bharat-not-bigger-than-khuda-allahabad-school-ma-convent-zia-ul-haq-bans-national-anthem-violates-islam-bjp-sp

    MA Convent, a private school in the Sadiabad district of Allahabad, has banned the playing and singing of the national anthem ‘Jan Gan Man’ and the national song ‘Vande Mataram’ after “objections from Muslim parents”, The Indian Express reported earlier on Sunday. The order was passed by Mohammad Zia-ul Haq, the manager of the school which is located in a MUSLIM DOMINATED locality.

    [The] national anthem has a line “Bharat bhagya vidhata” which is against Islam as Allah is our bhagya vidhata. How can we say Bharat has made our destiny? In the national anthem, the country has been described as being bigger and more important than ‘mazhab’ (religion) and ‘khuda’ (god) which would be unacceptable to any true Muslim - Mohammad Zia-ul Haq, Manager, MA Convent School, Allahabad

    Seven teachers and the principal have left the school following the order, terming Haq’s rationale behind it as “stupid, religious reasons”.

    National anthem had never been sung on the school campus, and could not be allowed as it was “un-Islamic”. I run a school and have to abide the parents. Teachers left the job as they had some other issues with the management. - Mohammad Zia-ul Haq, speaking to The Indian Express

    The school has 330 students; while 200 are Hindus, 130 students are Muslim.

    It is shameful that such a thing has been happening in the school for the last 12 years. A senior UP minister has ensured that no action is taken against the management. The SP government is giving protection not only to criminals and rapists but also to those who insult the nation and are anti-nationals. - Shrikant Sharma, BJP’s National Secretary

    ####################

    People of Hindustan demand BJP Govt to take action against this School which has banned from students from singing / playing Jana Gana Mana and Vande Mataram just because Muslim management of that school perceive it as Un Islamic. People of Bharat wants such schools shut down and management heavily fined.

    Urdu is the official teaching language in most of such schools where management and faculty are mostly muslims.

    It is extremely dangerous if Muslims think desh bhakti is anti-islamic and love or respect for motherland is against teachings of quran. Pseudo sickular politicians by not taking actions for vote bank politics are encouraging muslims to carve out another pakistan by dividing India once again.

    We all know what happened to Hindus of Hindustan for the past 800 years and we witnessed how Hindus were reduced to nothing in Kashmir, Bangladesh and Pakistan in the past 70 years.

    India's future is uncertain as long as patriotic feelings are not instilled into children's of all communities and religions.

    Government must think and prepare for a possible future scenario where like for example, if entire Islamic Nations (Saudi, UAE, Iran, Afghanistan, Pakistan, Bangladesh etc) decides to invade, loot and capture Hindustan and kill or convert the Kafirs in the name of Islamic Jihad, government must seriously think about if the Muslims of india will fight against foreign invasion or join with the foreign invaders and attack the Kafirs as per the teachings of the Quran waging islamic jihad against their own Motherland ?

    GOI / IB / RAW / NIA / Army etc must be prepared to deal with, repel and crush if such incidents which cannot be ruled out in the future. Internal and External Security agencies must ask themselves if they are well prepared and well equipped to confront such possible scenarios in the future. Government must create and fund patriotic think tanks who can lay out plans to eliminate enemies and defeat any threats to the unity, integrity and sovereignty of India in the future.

    ReplyDelete
    Replies
    1. dont let that guy come out of jail for a long time

      BHARAT BHAGYA VIDHAATA --

      he can please himself by contenting that allah is the dispenser of india's destiny

      http://ajitvadakayil.blogspot.in/2010/12/nobel-prize-and-knighthood-for-tagore.html

      Delete
    2. Captain it is sure after few years a new pakisthan will be formed from present india if such things keep to continue uniform civil code is need of moment.

      Delete
    3. If the news is true, the school banning jana gana mana is wrong as it is not considering the basic idea of subjects and objects in language. In Jana gana mana, Bharat is not the subject i.e. bhagya vidhata of the people as claimed by the this school. The subject is the Adhinayaka (commander) of the janata (Jana gana man adhinayak).

      Delete
  37. Hello Sir,

    If Tulsidas was a Fake creation by Rothschild, then who wrote Hanumaan chalisa?

    - Nilesh.

    ReplyDelete
    Replies
    1. http://ajitvadakayil.blogspot.in/2014/02/devadasi-system-immoral-lie-of-temple.html

      WHAT IS SO GREAT ABOUT HANUMAN CHALISA ?

      Delete
  38. Sir, Will Congress come back to power in 2019 if Priyanka Gandhi Vadra is made President of the Indian National Congress party and declared as the Prime Ministerial Candidate ?

    ReplyDelete
  39. Pranaam Captain

    I'm practicing Shirshaasana from a week for the first time in my life, its all because of the motivation you gave through your priceless blogs , thought if a goragaand is doing yog why can't me being Indian can do it . ,i used to feel drowsy after having meals, its gone now ,i feel like im on steroids now LOL, i can sense this warm electrifying feeling in my body through out the day,really Shirshaasana is the king of all aasanas .

    Captain ,is there any associated mantra with Shirshaasana to be recicted before or after the aasan ?

    ReplyDelete
    Replies
    1. Can u please share your experience on shirshasana how u started and how u balance

      Delete
    2. Hi,the first day was not great, this aasan requires a combined effort of shoulders,neck and spine ,on first day after a lot of fear managed to invert the body leaning on the wall but placed the hands wide and the entire weight fell on neck , so proper distance between the hands is to be cacalculated so that shoulders and neck shares the weight equally ,did no more than 5-6 seconds for three repetions , second day it was the same abused the neck but for a little longer ,on third day asked my mother to film me doing the aasan to rectify where was it going wrong and found that im placing the hands wide and corrected it ,it turned out great ,all the while leaning the lower body on the wall ,then slowly started stretching the spine this greately reduced the stress on neck and now only the tip of my ankles touches the wall ,im sure i can do it without the help of wall in another week or two

      Here are few tips

      warm up of shoulder rotator cuff muscles,neck, wrists ,triceps before the aasana will greately help and avoid injury

      Calculate the distance between hands according to width of your shoulders
      Calculate the point of your head where you will place the head below and invert the body ,watch some how how to videos on YouTube to understand this


      Delete

  40. http://timesofindia.indiatimes.com/india/Mercedez-Benz-seeks-lift-on-Supreme-Courts-ban-on-diesel-cars/articleshow/53594881.cms

    WHY ARE WE ALLOWING SUPREME COURT TO PLAY GOD ?

    WHO ARE THESE PEA BRAINED LAWYERS TURNED JUDGES ?

    ReplyDelete
  41. http://timesofindia.indiatimes.com/Government-to-enlist-gurus-for-organ-donation-campaign/articleshow/53590703.cms?

    WE DO NOT CONSIDER HOMOSEXUALITY PUSHING SRI SRI RAVISHANKAR A HINDU GURU .

    MR NARENDRA DAMODARDAS MODI , WE KNOW YOUR ROLE IN EXPORT OF KIDNEYS AND HUMAN BODY PARTS OFFICIALLY .. .

    WE WANT A LAW THAT INDIAN BLOOD AND INDIAN KIDNEYS CANNOT BE EXPORTED ABROAD . .

    ANY INDIAN GOVT WHO IS IN CONNIVANCE , IN THIS IMMORAL SCAM, DOES NOT DESERVE TO RULE INDIA

    ReplyDelete
  42. http://www.indiatimes.com/culture/who-we-are/watch-former-porn-star-mia-khalifa-points-out-the-problems-that-women-with-big-breasts-face-259562.html?utm_source=TOI_Homepage_Widget&utm_medium=referral&utm_campaign=Traffic_from_TOI_Homepage_Widget

    TOILET PAPER OF INDIA

    USED ON BOTH SIDES

    ReplyDelete
  43. http://www.femina.in/relationships/love-sex/3-steps-to-sexually-reconnect-with-him-15706.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    POOR PICKLE JOHN

    CHUTNEY MARY LOVES TOILET SEX WITH THE DIRTY PEON

    ReplyDelete
  44. captain sir,

    when i was kid, my parents used to tell me... god is everywhere and god see everything. You cannot hide from god and hence you will never commit sin. Recently there was traffic accident with my scooter and a girl from poor family was injured. I could not escape and didn't run away because for me life of a human is more precious and even after suffering financial loss i ensured proper medical treatment of that girl. This is what i am proud of being a HINDU.

    ReplyDelete
  45. Well Sir,

    What's your take on Modi's statement, "Gau Rakshaks are anti-social people"????

    ReplyDelete
  46. Aye Captain,

    what do you feel on indo pak nuclear war happening any soon??

    If any nuclear war entire west coast if INDIA is in grave danger

    http://zeenews.india.com/news/india/hizbul-chief-syed-salahudeen-warns-of-nuclear-war-between-india-pakistan-says-there-will-be-no-compromise-over-kashmir_1916341.html

    Thanks VKV

    ReplyDelete
  47. Sir
    An off topic question I Think Nikola Tesla is God because according to his family legend He was born midnight of July 10th during fierce thunderstorm and there was strong lightning when he was born.His mother's servant after he was born was afraid and said to his mother that it is bad omen to be born in this hour and due to fear she(servant) replied that he will be child of darkness.His mother replied boldly"No he will be child of light". which later became true.HE WAS CHILD OF LIGHT".THIS BROUGHT ME GOOSEBUMPS IN MY SPINE.Hatsoff to the true Martyr of science.

    Regards

    ReplyDelete
    Replies
    1. Every avatar of Lord Vishnu has taken birth in the pavitra dharti Bharat.

      This is #1 Reason I love this land.

      Delete
  48. Capt Sir
    Though u don't publish my previous comment I am again forced to comment again. I am going through a mental trauma ignited by two lallu christian officers at the work place. I am schedule to retire from force on completion of my engagement on 31 jul 17. I opted for a pre release course which initially was granted but they got it cancelled at last moment. This course has helped me to retire gracefully and a nokri in hand before leaving previous service.
    These thing are unbearable to some of officers. Now these officers want me to creat problem and they can show that I was not fit for service environment. I and my family staying at native place are suffering due to atrocities of these officers. I cannot go to higher hierarchy as they will spoil my whole future.
    Pls guide me sir

    ReplyDelete
    Replies
    1. BULLIES MUST BE CONFRONTED

      http://ajitvadakayil.blogspot.in/2011/07/bully-capt-ajit-vadakayil.html

      Delete
  49. WARNING:

    MODI MUST KNOW THAT PDP IS A DESH DROHI PARTY

    INDIA MUST NOT NEGOTIATE TWITH SEPARATISTS

    SEND A MESSAGE TO THE WORLD- KASHMIR IS NON NEGOTIABLE

    MEET STONE THROWERS WAVING PAKISTANI FLAGS WITH PELLETS-- IF THEY GET BLINDED SO BE IT

    JAIL ALL SEPARATISTS HOLDING INDIAN PASSPORTS

    COOL OF RELATIONS WITH PAKISTAN- WE DONT NEED THEIR FRIENDSHIP

    ReplyDelete
  50. Hi Captain,

    It seems like many of the acts by so called Gau Rakshaks and Cow Vigilantes are actually CONGRESS funded organizations used as a political conspiracy tool to portray BJP as an Anti-Dalit party so as to DIVIDE Hindu votes and to wedge away Dalits from Hindus so as to defeat BJP and win coming elections.

    Congress is behind Jat riots in Haryana and congress have also instigated Dalits to do mass protest after Una incident.

    ####################

    http://www.mediacrooks.com/2016/08/congis-antidalit-conspiracy.html

    ####################

    The investigation is still on and we do not know whether it was cow protection vigilantism or imposters of Congress/AAP who are making hay in the sunny secular debates but in spite of the matter being probed the media has blown this issue out of proportions. And the secular tourisms of polity and hypothecated humanity have already taken flight! What is even more intriguing is that the perpetrators had come to Una from Daman, 700 kms all the way to brutalize the poor Dalits, also the video that went viral was from a Telugu channel, whatever this channel was doing in Gujarat but Una is a Congress stronghold and a perfect platform to set the stage for the upcoming 2017 assembly elections. Amusingly as per an Indian Express report 2 Muslim boys were among the arrested who had flogged the Dalit family members in Una, since when did the Muslim community take up the cause of cow protection ???

    Benami Media cleverly and significantly segregates Hindus, Dalits, Adivasis, Scheduled Castes, Scheduled Tribes as various distinct entities. Isn’t that a common secular strategy ? That’s the first line of attack of secularists. Separate Hindus into different groups.

    The tactic is clear. Muslims-Dalits-Adivasis become the goats on which the conspiracy of hatred will be hatched by Sickulars and Commie media.

    Congress did their very best in projecting BJP as Anti-Muslim and Anti-Christian party before 2014 Election. It did not work. Now Congress is trying to divide and wedge away Dalits, Adivasis, SC / ST's from Hindu community. Islamic parties like AIMIM of owaisi are using this opportunity to form a Dalit-Muslim political alliance. We all know what their divisive Islamic Agenda of these Muslim politicians are.

    BJP must punish foreign funded benami indian Media who funds and organize fake communal events and blows everything out of proportion and are in cahoots with Congress, AAP, Commies, NGO's, Lefties, Sickularists, Pseudo Intellectuals etc to divide India by dividing Indians.

    Pseudo Sickular opposition parties are all ganged up against BJP and are trying hard to portray BJP as Anti-Dalit party and Congress aims to defeat BJP in Gujarat in 2017 Election and Win 2019 lok sabha elections by dividing Hindus.

    What PM Modi needs to also do now on an urgent basis is to have a proper PMO Spokesperson to dismantle lies of Sickulars and Media on a regular basis or when needed. PM must be allowed to Govern the nation and it should not be left to events of the PM to indulge in combating the Conspiracies hatched by cunning divisive opposition party politicians. The Sickulars and corrupt Media are not merely anti-Hindus, they play the agenda of their bosses abroad and this is no secret. Neither Gujarat nor India is rotting as Media barons would like people to believe. India is doing better than ever before. This Anti-Dalit conspiracy is a concoction of sick, evil minds that have never done anything for their upliftment.

    ReplyDelete
    Replies
    1. INDIAN POLICE AND JUDICIARY MUST BE TRAINED ABOUT "FALSE FLAG ATTACKS" AND HEGELIAN DIALECTIC.

      KHACHRAWAAL USED FOREIGN CHRISTIAN HELP TO DO FALSE FLAG ATTACK ON CHURCHES AND WIN DELHI ELECTIONS.

      AND HINDU VANDLISERS VERY CONVENIENTLY LEFT SAFFRON FLAGS AND HANUMAN IDOLS AFTER THE ATTACK

      OUR JUDICIARY MUST BE CLEANSED OFF DESH DROHIS-- A LOT OF THESE JUDGES LIVE WAY BEYOND THEIR MONTH END SALARIES.

      Delete
  51. http://www.femina.in/relationships/love-sex/what-women-really-think-during-oral-sex-15792.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA-

    USED ON BOTH SIDES

    ReplyDelete
  52. Hi Ajit,
    You can decipher this. AAP is playing a dangerous Game and what I presume Khujli's 12 day Vipasana is just a cover up :1 https://twitter.com/leopard212/status/762605825651249152 2. https://twitter.com/DrGPradhan/status/762633609354280960

    With best wishes,

    Sushanta Das

    ReplyDelete
    Replies
    1. EVEN TODAY MODI AND OUR NATIONAL SECURITY AGENCIES DO NOT KNOW HOW AAP WON 4 LOK SABHA SEATS IN PUNJAB--- DURING THE MAY 2014 ELECTIONS.

      Delete
    2. Hi Ajit,

      Is it drug money & ISI Cahoot ?

      Sushanta Das

      Delete
    3. hi skd,

      our security forces should have found out by now how AAP got 4 loksabha seats in 2014.

      khalistanis ( NIL turban ) have set shop in pakistan and they now control the drug trade to punjab.

      the original khalistani leaders were ALL crypto jews -- people with pale eyes --wearing 5K

      very soon there will be SIKH REGIMENT in British and Canadian army.

      already sikhs in KNEDAAA and England and saying that they have nothing to do with india.

      http://ajitvadakayil.blogspot.in/2013/07/unknown-history-of-sikhs-and-sikhism.html

      Delete
    4. Hi Ajit,

      I have read your post mentioned above and you have mentioned about Crypto jews many times in you comment.it's really intriguing and AAP role is very very dangerous for the security of our Country now they have established themselves in North East.1 https://twitter.com/DrGPradhan/status/761617766289928193 2 https://twitter.com/DrGPradhan/status/761630283099672576 3 https://twitter.com/DrGPradhan/status/761627839884103

      This is enough to decipher the AAP/Naxal and other AntiNational nexus


      With best wishes,

      Sushanta Das

      Delete
  53. Capt,
    Will you please share your thoughts on orgonan pyramids

    ReplyDelete
  54. Hi Capt.

    I have been reading your blog for last 3-4 years. It's the homepage of my laptop and bookmarked in phone. I have not been commenting or asking any questions since 3-4 years because all the knowledge you have written here is truth which we don't need to question. You have cleared so many doubts of mine the information here is as good and true as brahmagyan. I don't know if my small thank you would count.
    One major concern of mine is the media these days they are publishing bullshit few days back indiatimes published an article the head line was "the world without muslim is impossible" It made my blood to boil. Can I use your article contents to answer those one god people and let them know about their coward four fathers.
    Thank you so much sir

    ReplyDelete
    Replies
    1. A RELIGION MUST DELIVER PEACE, LOVE , HARMONY, HOPE, FAIRNESS .

      DOES ISLAM DELIVER THAT ?

      EVERY HINDU ON THIS PLANET TODAY MUST BE PROUD OF HIS ANCESTORS

      THEY WALKED THROUGH FIRE DURING 800 YEARS OF SLAVERY AND EXTREME PERSECUTION , YET HUNG ON TO THEIR FAITH

      THEY DID NOT FALL TO FEAR OF SWORD OR GREED OF SOPS

      MOST INDIAN INDENTURED LABOUR DID NOT STAY BACK IN FOREIGN LANDS , BECAUSE THEY WISHED TO.

      THEY WERE OFFERED A RETURN PASSAGE FREE OF COST IF THEY CONVERTED TO CHRISTIANITY

      I DID NOT WRITE THIS IN MY POST BELOW

      http://ajitvadakayil.blogspot.in/2010/04/indentured-coolie-slavery-reinvented.html

      MY REVELATIONS NOW JUMP TO 21.60 %

      SELECTIVE AMNESIA WILL NOT WORK ANY MORE

      THOUSANDS OF TEMPLES HAVE BEEN DESTROYED IN PAKISTAN ,BANGLADESH AND KASHMIR SINCE 1947. THE HINDU POPULATION HAS DWINDLED ALARMINGLY

      THE WHOLE WORLD KEPT QUIET.

      HAS MODI EVER MENTIONED THIS?

      HAS RSS EVER MENTIONED THIS?

      WHAT IS RSS WORTH ? TODAY RSS CALLS GAU RAKSHAKS CRIMINALS .

      WE KNOW THAT GUJJU NO 2 MODI AND RSS WERE INSTRUMENTAL IS DECIMATING OUR PRICELESS HUMPED VEDIC COWS , AND REPLACING THEM WITH USELESS HUMPLESS JERSEY COWS

      http://ajitvadakayil.blogspot.in/2013/07/nutritious-a1-milk-of-vedic-cows-with.html

      WHY WAS ZAKIR NAIK ALLOWED A FREE RIDE IN INDIA, PREACHING HATE ?

      WHY IS THE COLLEGIUM JUDICIARY SOFT OF JNU COMMIES WHO PREACH SEDITION ? WE KNOW --

      LET THESE JUDGES NOT GET TOO SMUG -- ONE DAY ANOTHER JUDGE WILL CONDEMN THESE TRAITORS AND SEND THEM BEHIND BARS. ONE DAY THEY WILL RETIRE . .

      WE THANK KATJU AND BHUSHAN FOR EXPOSING THE CORRUPT BASTARDS WITHIN THE JUDICIARY.

      capt ajit vadakayil
      ..

      Delete
    2. Indiatimes, MenXP, ScoopWhoop these are all social media websites of TOILET PAPER OF INDIA.THESE ARE ALL CONTROLLED BY TIMES

      Delete
    3. VENKATAIH NAIDU IS NO DIFFERENT FROM ARUN JAITLEY

      NATIONAL NEWSPAPERS PEDDLE PORN.

      THIS IS ALL "POUND OF FLESH" FOR APCO BRANDING

      WHY IS SRI SRI RAVISHANKAR AND SADGURU JAGGI VASUDEV PEDDLING HOMOSEXUALITY AND THAT TOO ON TV OPENLY ? THEY GET KOSHER FAAYADA .

      Delete
  55. captain, I recently bought a parad shivlingam weighing around a 100 GM's from a shop at holy Trimbakeshwar. the shopkeeper told me it is 93% pure and also that it is the highest percentage of purity possible. Sir can u tell what is the highest percentage of purity possible for a parad shivlingam and possibly where one can buy purest of parad lingam.net is not of much use for this query.it's like ur blog has opened the doors to a long lost library of our ancient science and I want to make the best use of it.Please answer my query. Sincerely Ramas

    ReplyDelete
  56. http://timesofindia.indiatimes.com/city/meerut/Fresh-Deoband-fatwa-Dont-offer-namaz-while-wearing-wig-artificial-beard/articleshow/53606179.cms

    WHAT ABOUT MUSLIMS MAKING ZEBIBA MARKS USING ACID AND LIMESTONE, TO GRAB FAALTHU POWER ? . WILL YOU PUNISH THESE FAKES . ..

    ReplyDelete
  57. TREAT REFUSAL TO SING THE NATIONAL ANTHEM AS A VERY SERIOUS ISSUE.

    WHY IS THE NHRC AND COLLEGIUM JUDICIARY AFRAID OF JEW NOAM CHOMSKY ?

    CHAKKAR KYA HAI ?

    WE KNOW !

    ReplyDelete
  58. RSS CHIEF MOHAN BHAGAWAT SAYS THAT "COW IS INTEGRAL TO INDIAN AGRICULTURE "

    BASSSS ?

    THIS STATEMENT WILL HIT THE BJP GOVT HARD -- AFTER ALL RSS CONTROLS THE MODI GOVT

    WHAT A PATHETIC STATEMENT FROM THE RSS CHIEF !

    WHEN DID RSS LAST DO SOMETHING FOR THE HINDUS ?

    TODAY RSS HAS STOOPED SO LOW THAT THEY PROMOTE HOMOSEXUALITY

    IT WAS THE HOMOSEXUAL CHITPAVAN JEWS NAY BRAHMINS WHO WENT GA GA ABOUT SEMEN RETENTION

    THEY PRETENDED THAT THEY DID NOT MARRY FOR A SPIRITUAL REASON .

    SINCE WHEN DID SHOVING A PRICK INTO ANOTHER MANs ASSHOLE BECOME SPIRITUAL?

    ReplyDelete
  59. http://timesofindia.indiatimes.com/city/imphal/Iron-Sharmilas-16-year-long-fast-set-to-end-today/articleshow/53608475.cms

    IROM SHARMILA -- FOREIGN CONTROLLED WOMN-- FUCK OFF

    AFSPA WILL BE WITHDRAWN ONLY WHEN THE GOVT DECIDES .

    WE DO NOT WANT OUR COLLEGIUM JUDICIARY ( WHO IS AFRAID OF ROTHSCHILDs DOUBLE AGENT JEW NOAM CHOMSKY ) TO DEAL WITH CASES OF SEDITION AND THREATS TO THE WATAN

    ReplyDelete
    Replies
    1. CAPTAIN!
      A JOKE ON HER..
      " it took 16 years for Iron Sharmila to realise that nose is for breathing and mouth for eating.."" he he...

      such fasts end as soon your financers(NGOs) run away..

      Delete
  60. http://www.femina.in/relationships/love-sex/sex-positions-that-can-get-really-awkward-16186.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    YOU CALL TIMES OF INDIA A NATIONAL NEWSPAPER?

    AAARRRGGHH PPTTHHEEOOOYYYY !

    ReplyDelete
  61. ADI GODREJ RIDICULED HINDUS IN A SPEECH AT IIT MUMBAI , QUOTING A "HINDU RATE OF GROWTH IN EXTREME SARCASM

    THE ENTIRE HALL, ALMOST ALL HINDUS , RESPONDED WITH LOUD CHEERS

    THIS SHOWS HOW SELF LOATHING HINDUS HAVE BECOME

    WIKIPEDIA TOOK OPPORTUNISTIC LEVERAGE AND NOW HAS AN ARTICLE ON IT

    https://en.wikipedia.org/wiki/Hindu_rate_of_growth

    DOES ADI GODREJ THINK HIS PARSI COMMUNITY ARE THE CATS WHISKERS ?

    THE PARSIS WERE RADDHIWAALAS TILL JEW ROTHSCHILD USED THIS UNGRATEFUL IMMIGRANTS AS THEIR PARTNERS FOR DRUG RUNNING

    http://ajitvadakayil.blogspot.in/2010/11/drug-runners-of-india-capt-ajit.html

    WE GAVE THIS COMMUNITY REFUGE AND THEY KICKED BHARATMATA IN HER TEETH AT THE FIRST OPPORTUNITY.

    ON THE CONTRARY--

    AS LONG AS THERE WAS "HINDU RATE OF GROWTH ", INDIA WAS THE NO 1 ECONOMY ON THE PLANET FOR MILLINIUMS .

    THE WHITE INVADER REVERSED ALL THIS USING HIS PARSI STOOGES

    THIS WE DONT SAY

    THIS THE WHITE MAN ADMITS

    WE ASK THE GOVT TO ENSURE STUDENTS ARE NOT LED ASTRAY

    DO NOT LET FOREIGN FUNDED NGOs CONVERT INDIAN UNIVERSITIES INTO ANOTHER JNU-- A DEN OF COMMIE TRAITORS.

    ReplyDelete
    Replies
    1. they have a general hospital in mumbai exclusively for themselves .......talk about inbred racism.....no wonder they are going extinct like the dinosaurs

      Delete
  62. Captain what do you think about upcoming movie shivaay the trailer shows that Ajay devgan is shiv bhakt in movie and recites some Shiva strotam in trailer
    What do u think this too will turn out like Amish tripathi books
    The comments of YouTube video shows Hindus have stopped being self loathing

    ReplyDelete
  63. THIS BLOGSITE WARNS NARENDRA DAMODARDAS MODI

    DO NOT ALIENATE HINDUS ANYMORE BY UNFOUNDED REMARKS ABOUT HINDUS AND COWS --JUST TO MILK DALIT VOTES --

    SHOOT ME DONT SHOOT DALITS BOO HOOOOO--

    BJP MERI MAAA HAI --BOOO HOOOOO

    THIS IS THE PITS IN HYPOCRISY

    PEOPLE WILL TAKE LAW INTO THEIR OWN HANDS, ONLY WHEN THE LAW MACHINERY FAILS--

    WE HINDUS DO KNOW THAT GUJJU NO 2 MODI DO NOT LIKE OUR VEDIC HUMPED COWS -- WE KNOW HOW GUJARAT INTRODUCED WHITE REVOLUTION IN INDIA.

    WE KNOW HOW OUR HUMPED VEDIC COWS WERE MADE TO ROAM AROUND UNCARED LIKE BEGGARS AND DESTITUTES BY HINDU LEADERS IN THE PAYROLL OF KOSHER FORCES . OUR PRIZED HUMPED BULLS WERE CASTRATED

    LOOKS LIKE MODI HAS FORGOTTEN TH RESOUNDING SLAPS HE GOT IN THE DELHI AND BIHAR ELECTIONS

    MORE ARE ON THE WAY

    BIG MISTAKE MR MODI

    BEST IS TO KEEP QUIET-- DO NOT GO ON AND ON--

    MODI SPOKE FOR ABOUT 3 HOURS--YET THE BENAMI MEDIA HAS ONLY THE COW THING TO REPORTS--ALL OF THEM

    AND BEWARE OF DROHIS LIKE ARNAB GOSWAMI WHO OPPORTUNISTICALLY MILKED THE JNU EPISODE FOR TRP AND PERSONAL FAYADA

    HE IS ANTI WATAN AND ANTI HINDU --

    http://ajitvadakayil.blogspot.in/2013/07/nutritious-a1-milk-of-vedic-cows-with.html

    TODAY JALIKKATTU IS BEING BANNED BY PEOPLE IN THE PAYROLL OF FOREIGN FORCES

    WHY ALLOW BOXING IN OLYMPICS ?

    JALLIKKATU IS FINE AS LONG AS NOBODY YANKS THE BULLS TAIL. NO BULL HAS EVER DIED

    AN INDIAN HUMPED BULL CAN RUN TWICE AS FAST AS A FOREIGN HUMPLESS BULL

    ReplyDelete
    Replies
    1. Hi Captain,

      You are right. PM Modi could have just kept quiet instead of giving dramatic speeches to milk dalit votes. PM need not react to such fake communal issues and could have avoided it. Most people who doesn't know that these anti-dalit incidents are funded and organized by Congress might have felt alienated by his speech.

      There are many Gau Sevas and Ghoshalas that are preserving vedic indian humped cows. People do not care if humpless jersey cows are slaughtered or exported as beef.

      Congress cunning game plan is to SPLIT 12% Brahmin votes in Uttar Pradesh by portraying BJP as Anti-Gomata (by forcing PM to speak against Gau Rakshak) on one side and also to SPLIT Dalit Votes and wedge away Dalits from HIndus and from BJP by orchestrating Una incident (Congress stronghold).

      As per Congress agenda, they expect Brahmin and General Caste Hindu votes to splinter and go to them (CM candidate Sheila Dixit), while Dalit plus Muslim votes will be going to either Mulayam's SP or Mayawati's BSP leaving BJP without any viable vote bank. Congress may then give support via backdoor to either SP or BSP to keep BJP out of power in coming 2017 election in UP.

      BJP is Anti-Muslim did not work. BJP is Anti-Christian did not work. The new weapon of Congress, AAP, Commies and Media is to portray BJP as both Anti-Brahmin as well as Anti-Dalit to divide hindus and split hindu votes and expects to come to power in UP ad Gujarat in 2017 and in India in 2019.

      BJP must ban media who almost everyday constantly dish out fake news about dalit this and dalit that as if dalits are some distinct community who has nothing to do with hinduism. Govt must punish benami indian media and their barons who are dividing Indians. Instead of reporting facts, Media pours oil on fire and blows everything out of proportion.

      JNU, Jadhavpur, Rohit Vemula, Una, Dadri, Award Wapsi, Kashmir unrest, Intolerance brigade etc are all false flag attacks aimed at dividing India.

      India do not need enemies from outside where there is the fifth column (Mainstream Media) working hard to make India implode from within.

      BJP must soon start to think about Ram Temple at Ayodhya, Implementing Uniform Civil Code (UCC), revoking Article 370, Freeing Hindu Temples from Govt control etc if they wish to win 2019 elections.

      Delete
    2. IF YOU DO NOT WATCH TV NEWS

      AND

      DO NOT READ NEWS PAPERS

      INDIA IS A NATION WORTH LIVING IN-- FULL OF LIFE , FULL OF HARMONEY

      THE BENAMI MEDIA DIVIDES INDIA -BY GIVING ALL FALSE NEWS

      IF AN OLD WOMN IS RUN DOWN BY A TRUCK WHILE CROSSING THE ROAD

      THE TV BREAKINGNEWS WILL BE--

      OLD WOMAN RAPED AND MURDERED ON ROAD.

      EVEN MUGHAL EMPERORS DID NOT ALLOW OPEN COW SLAUGHTER AS A POLICY-- BECAUSE THEY KNEW THE COW THINGY WILL UNITE THE HINDUS

      MODI HAS CUT HIS OWN FEET--

      IN ANY CASE GUJJU NO 2 IS ONE OF THE MAIN CHARACTERS OF THE WHITE REVOLUTION CONDUCTED BY DESH DROHI VERGHESE KURIAN

      Delete
  64. https://twitter.com/IndianExpress/status/762536098216091648

    SITARAM YECHURY WILL LAND UP IN JAIL FOR SEDITION SOON

    HIS WIFE IS THE RESIDENT EDITOR OF INDIAN EXPRESS

    ARNAB GOSWAMI DROOLED ON TV WHEN HE CRIED " YECHURY IS AN INTELLECTUAL GIANT"

    OH YEAH ?

    HIS INTELLECT AND HIS KNOWLEDGE OF COMMUNISM , CAPT AJIT VADAKAYIL CAN HOLD UNDER HIS LITTLE FINGER NAIL--

    WITH SPACE FOR MORE.

    BENAMI MEDIA CANNOT MAKE GODS ANYMORE

    THOSE DAYS ARE LONG GONE

    ReplyDelete
  65. Dear Captain,

    Is Varnasrama ok? Or is it against the Watan's Economic development?

    Because, Gandhi was also into these so called Ahimsa, Rural Development, Varnasrama, Self-sufficiency.

    So I doubt it, whether it is a ploy of the Whites.

    I feel that,t Varnasrama can be a good solution to tackle many modern problems like -

    1. Denying cows/bulls (Especially vedic humped Indian A2) and lands
    2. Usage of Tractors, which sterile the land.
    3. Not looking into Nature
    4. Food Adulteration.

    Having you (reading your blogs) is one of the best things I am doing among my births!

    Bharat Mata ki Jai!

    ReplyDelete
  66. Shobha De criticized our Indian Olympic players in twitter and got good heated response from everyone. She is working in one of our national media like NDTV and did like this.I still don't understand why MODI's government is still F****ng silent about these MOTH EATEN Faces who criticize INDIA publicly

    ReplyDelete
    Replies
    1. THIS KALANK TO INDIAN WOMANHOOD SHOBHA DE IS NOT EVEN WORTH MY GARBAGE BUCKET LIST.

      Delete
    2. Captain please remove adi shankaracharya from vadakayil prize list what next lord ayappa and krishna too
      Captain this is exceeding u dont deserve to nominate adi shankaracharya its too much

      Delete
  67. Dear Captain,

    From reading your posts, I came to know that Lord Hyagriva is a 'Creation'.

    If so what about Lalita Sahashranamam, that is dialogue between Hyagriva and Sage Agastya?

    Lalita Sahasranama deals more about Sri Chakras, Mudras, 7 chakras of the body. It is like a yogic text!

    ReplyDelete
    Replies
    1. ASK THE BIGGEST EXPERT IN SANATANA DHARMA WHAT IS BRAHMANA AND ARANYAKA ?

      CHECK OUT IF HE KNOWS

      THE VEDAS ( SRUTI )HAS 4 PARTS OF WHICH THESE ARE PARTS 2 AND 3.

      THEY DEALT WITH LIFE SCIENCES AND WERE HENCE PRICELESS

      THE WHITE INVADER JUST STOLE IT -- AND WE INDIANS ARE GA GA ABOUT PARTS 1 AND 4.

      Delete
  68. http://timesofindia.indiatimes.com/city/vadodara/Gujarati-NRI-returns-to-work-for-gau-raksha/articleshow/53609376.cms

    the BASTARDS of the benami media is showing HUMPLESS foreign cows

    we do NOT care if all the HUMPLESS JERSEY COWS in india are killed

    we care only for HUMPED vedic cows

    ReplyDelete
    Replies
    1. Hi Sir,

      If you search YouTube for children rhymes, not one video has humped vedic cows. Everything shows ugly Jersey cows.

      Thanks,
      Srinu

      Delete
  69. modi speaks against Gau rakshaks but utter not a word against gau bhakshak or those who are slaughtering cows illegaly..

    day after day presstitutes are bleeding Bharat Mata internally, he is silent and grooming people like Arnab just to get in the good books of sikular journalist.

    on defence - it appears that we are more close with US/Nato countries than russia.
    what has modi done for HIndus,contrarily he lashes hindus as if ""APNAICH MAAL HAI".
    i have a feeling this guy is surely A FEKU and care about his position , appearance more than anything else..This guy just to please muslim,and dalits can go to any extent.. if so then whats the difference between him and congress.

    He dosnt have bad advisiors, he himself is bad.

    Captain! had told that he waS researching on his family history . how long do we have to wait captian. please write down the post and bring down this man.
    THE DAY HE SAID "PEHLE DEVALAYA FIR SAUCHALAYA" WE SHOULD HAVE UNDERSTOOD WHETHER HE LOVES HINDUISM OR NOT.

    ReplyDelete
  70. Respected Captain Vadakayil
    I am sorry but I am asking you this question once again. Do the petrified forests with strange crystal growth in the US have anything to do with Jambudweep and Varaha avatar of Lord Vishnu? The curiosity is killing me!
    Regards

    ReplyDelete
  71. http://timesofindia.indiatimes.com/india/Manipurs-Iron-Lady-Irom-Sharmila-ends-16-year-long-hunger-strike/articleshow/53616970.cms

    IROM SHARMILA FOR PRESIDENT

    TEE HEEEEEEEE

    ReplyDelete
  72. http://timesofindia.indiatimes.com/india/Shobhaa-De-please-learn-sportsmanship-from-Big-B/articleshow/53615972.cms

    SHOBHAA DE --

    A KALANK TO INDIAN WOMANHOOD AND A DISGRACE TO INDIA

    ReplyDelete
  73. http://timesofindia.indiatimes.com/nri/nri-achievers/10-year-old-boy-achieves-maximum-possible-score-of-162-in-Mensa-IQ-test/articleshow/53615269.cms

    JEW ALBERT EINSTEIN HAD BELOW AVERAGE IQ

    http://ajitvadakayil.blogspot.in/2014/08/yellapragada-subbarow-nobel-prize-and.html

    STEPHEN HAWKINS WHO SAYS THERE IS NO CREATOR GOD --

    I DARE HIM TO TAKE AN IQ TEST , I PREPARE--IT WILL NOT BE THE MUNDANE MENSA TYPE MODEL.

    MENSA TESTS ARE NOT A BENCHMARK OF IQ

    ReplyDelete
  74. Captain,
    This is for the benefit of reader RT S from Canada, please publish this for all facing such issues.

    "Me, me is totally correct. Before sending to her parents in India, first consult Psychologist /Marriage counsellor in Canada. Laws in Canada are more gender-neutral!
    In India she will file for divorce and as soon as she gets a lawyer, the lawyer will ask her to add cases of 498A, Dowry, domestic violence against your WHOLE FAMILY.
    You are the one going to pay damages, and your property will be divided- even if it is your parents.
    Indian laws are very, very biased. Plus greedy lawyers.
    Has she ever given 'suicide threats" also?
    Please watch these two videos -
    https://www.youtube.com/watch?v=FdFVaqWAwE0
    https://www.youtube.com/watch?v=LvbNTsuLnk8

    Please keep in mind - your parents, sister, brothers, etc. all have risk of facing cases against them to pressurise you.

    Visit this site :http://www.shoneekapoor.com/;
    If possible, call them and talk to them-http://www.shoneekapoor.com/contact-me/

    Take this seriously and do this before getting her tickets, man."

    P.S.: Regarding the daughter,do fight, but realistically chances of father getting custody are nil/near zero in India, even if the wife has psychological issues! Be prepared; try for visitation rights.

    ReplyDelete
  75. WE HAVE SEEN EMBEDDED JOURNALISTS-- WE KNOW WHAT THEY DO.

    http://ajitvadakayil.blogspot.in/2012/11/embedded-journalism-immoral-and-false.html

    i know arnab goswami will read this

    be careful maan

    unless ( like barkha dutt ) you want to land up one page 1 as item 1 in any google search--for being the

    DOUBLE AGENT JOURNALIST

    you morbid hate towards hindus and india flashes often --

    capt ajit vadakayil is now watching every inch of your progress

    i will give you a last chance

    or be damned forever

    i know your type bravado-- this is water off a ducks back

    TRY ME !

    ReplyDelete
  76. Hi,
    Previous comment went too long,may not be published,so short reply-
    'Me, me' is totally correct.
    Please visit these links and do your homework. Indian laws and lawyers are really biased. Especially 498A, etc.
    Check these-
    https://www.youtube.com/watch?v=FdFVaqWAwE0
    https://www.youtube.com/watch?v=LvbNTsuLnk8
    http://www.saveindianfamily.in/

    ReplyDelete
  77. Pranaam Captain

    please explain the 234 theory on Gandhi's assassination put forward by Subramanian Swamy ,its evident that he knows some inside secrets of nehru's family ,no gandhi ever dare to pull the leg of mr.swamy

    ReplyDelete
    Replies
    1. AFTER INDEPNDENCE GANDHI WAS SIDELINED

      ROTHSCHILD WHO PUT GANDHI ON A PEDESTAL DUMPED GANDHI

      BUT GANDHI KNEW TOO MUCH- AND BITTER GANDHI , HIS EGO CRUSHED WAS IN A "I WILL REVEAL ALL " MODE

      HE WAS SILENCED

      GANDHI NEVER SAID "HEY RAM"

      THERE WERE 4 SHOTS FIRED NOT 3.

      WHO ORDERED THAT THERE MUST BE NO POST MORTEM ?

      Delete
    2. This gujju no.1 is the most unstable character in history , some times he supports traditional business models and asks to support the oppressors , preaches ahimsa and recruits millions of soldiers to fight for britain
      ,wishes for a Rama rajya and calls ramayan,mahabharat communal and misguided,starts the khilafat movement & opposes the partition of india and gain does a fast to provide financial aid to the partitioned country, WOW , he is a perfect example of MK ULTRA brain washing

      but Captain im really confused , who ordered there must be no post mortem , nehru ? the judiciary on R's pay roll ? his family ?
      i can no more believe the reports of MSM

      and why the reports faked the count of bullets , is there any other person involved in the firing other than godse ?

      Please Reply

      Delete
  78. Hi Ajit,

    Now Law Minister is woke up see :1 https://twitter.com/CNNnews18/status/762975691017035778 2 https://twitter.com/CNNnews18/status/762975420803190786 3 https://twitter.com/Leopard212/status/761474111075942400

    So I hope Govt. has taken some steps for NJAC

    With best wishes,

    Sushanta Das

    ReplyDelete
    Replies
    1. IF JUDGES DO NOT FOLLOW THE CONSTITUTION , THE WAY OUT IS TO WARN THEM FIRST

      THEN JUST STOP THEIR SALARIES !

      WITHDRAW ALL PERSONAL PROTECTION .

      JUST WHO THE HELL ARE THESE "LAWYERS TURNED JUDGES '?

      READ ALL 7 PARTS OF THE POST BELOW--

      http://ajitvadakayil.blogspot.in/2016/03/foreign-funded-trojan-horse-ngos-pil.html

      WE DO NOT WANT COLLEGIUM JUDICIARY TO DEAL WITH THREATS TO BHARATMATA .

      INDIA CANNOT BECOME A SUPERPOWER AS LONG AS JUDGES, MEDIA AND RAJYA SABHA MPs ARE DESH DROHIS IN THE PAYROLL OF FOREIGN FORCES.





      Delete
    2. Hi Ajit,

      There is more to come on this .You see what he is telling :http://timesofindia.indiatimes.com/india/To-protect-judiciary-we-can-even-call-Army-SC/articleshow/49666608.cms and this is the provision :https://pbs.twimg.com/media/CpbNOf2XgAAt3_4.jpg Now Law Minister is telling it's PM's Authority to appoint

      Sushanta Das

      Delete
    3. 26 MONTHS HAVE PASSED, WITH MODI ENSCONCED ON THE PM CHAIR

      APCO MODIs ENTIRE EFFORTS HAVE GONE INTO BUILDING UP HIS OWN PERSONAL CHARISMA ABROAD , BEGGING FOR MONEY ( THIS IS DEBT - NOT CHARITY ) AND MILKING DALIT/ MUSLIM/ CHRISTIAN VOTES

      I AM WATCHING

      SHOOT ME --KINDLY PLEEAAJJE --DONT SHOOT MY DALIT BROTHERS -BOO HOOOOOOOO

      BJP MERI MAAA HAI-- BOOO HOOOOOOOOOOO

      WATAN ALWAYS LAST , RIGHT ?

      MODI WANTS PEOPLE TO GIVE HIM SUGGESTIONS ON THE INTERNET -- HE WILL ONLY TAKE SUGGESTION WHERE HE CAN PERSONALLY SHINE.

      Delete
    4. WHENEVER JUDICIARY GRABBED EXTRA-CONSTITUTIONAL POWER , IT HAS ALWAYS HAPPENED BY HEGELIAN DIALECTIC-

      -- CONTROLLED BY FOREIGN FORCES

      Delete
    5. Hi Ajit,

      Now most Explosive news :https://twitter.com/DrGPradhan/status/763065249754906624 on the suicide note of Arunachal Pradesh Ex-CM Kalikho Pul Suicide Note

      Sushanta Das

      Delete
    6. http://timesofindia.indiatimes.com/india/To-protect-judiciary-we-can-even-call-Army-SC/articleshow/49666608.cms

      WHAT MAKES THE COLLEGIUM JUDICIARY THINK THAT ARMY WILL TAKE ORDERS FROM THEM ?

      WHY HAVE "LAWYERS TURNED JUDGES " BEEN ALLOWED SO MUCH LEEWAY ?

      Delete
  79. Dear Sir,

    How do you assess this report?

    Turkey coup has links in India, says consul general in India, Erdal Sabri Ergen

    http://www.financialexpress.com/india-news/turkey-coup-has-links-in-india-says-consul-general-in-india-erdal-sabri-ergen/341470/?Socialmedia

    Best Wishes.

    ReplyDelete
  80. Hi Ajit,

    Now the Collegium Judiciary playing God and Exposed Well.How They have asked for money is in the suicide note.So NJAC will be formed and what I learned the Delhi Govt. Can't contest the role of LG in SC as per Provision.

    Sushanta Das

    ReplyDelete
    Replies
    1. AAP MUST NOT BE ALLOWED TO COME TO POWER IN ANY STATE WHERE THERE ARE FOREIGN FUNDED/ ARMED/ CONTROLLED SEPARATIST PROBLEMS.

      INDIAN SECURITY FORCES MUST DO THEIR JOB -- TRACK KHUJLIWAAAL , TAP HIS PHONES-- WHATEVER.

      IN HIS PATHETIC AND RECKLESS ENDEAVOUR TO MILK VOTES NARENDRA DAMODARDAS MODI HAS NEGLECTED THE SECURITY OF THE WATAN.

      Delete
    2. Hi Ajit,

      I think this August Sept. will be crucial for India and many thing may come to light. The Tussel between Elected and Collegium will come out openly .130 Cr from AAP MLA seized and khujli on Vipasana in Dharmashala I think a planned strategy not to face Media ,and presume smell rats earlier.Kalikho Pul case may unmask the nexus of SC and involvement of certain SC Lawyers may be Bunty Sibal and Singvi with AG Mukul for dilution.

      With good Wishes,

      Sushanta Das

      Delete
    3. BJP TALKS ABOUT CONGRESS MINISTERS BEING SLAVES OF THE WAITRESS.

      WHAT WE SEE IS THAT BJP MINISTERS ARE BIGGEST SLAVES -

      THEY ALL WORK 100% TO IMPRESS NARENDRA DAMODARDAS MODI --BHAAD MEIN GAYE WATAN

      WE KNOW WHY LAW MINISTER RAVISHANKAR PRASAD DOES NOT WANT NJAC --

      BLOODY HYPOCRITES ALL

      Delete
    4. Hi Ajit,

      Is it to confuse the naive using the Hegelian Dialectics ?

      Sushanta Das

      Delete
    5. collegium judiciary grabbed power in india by using HEGELIAN DIALECTIC and PIL from foreign funded NGOs .

      the desh drohi judges must not breathe easy

      their time will come.

      even amma went to jail --nobody is immmune

      Delete
    6. Hi Ajit,

      Yes it seems so after so mush shadow fight.Modi play the cow card because of this :https://twitter.com/DrGPradhan/status/763398818322911233 and https://pbs.twimg.com/media/CpgjHhXW8AQbehS.jpg
      Sushanta Das

      Delete
  81. http://timesofindia.indiatimes.com/Humane-touch-missing-in-JK-key-to-curb-unrest-SC/articleshow/53625211.cms?

    WE THE PEOPLE OF INDIA DO NOT WANT COLLEGIUM JUDICIARY TO PLAY GOD IN KASHMIR . . .

    ReplyDelete

  82. ######## COLLEGIUM JUDICIARY PLAYING GOD #######
    INDIA IS THE ONLY NATION ON THIS PLANET , WHERE COLLEGIUM JUDICIARY ELECTS JUDGES . .THEY SCUTTLED NJAC . . .
    IN THE RECENT PAST COLLEGIUM JUDICIARY SAVED SEVERAL TRAITORS WHO HAVE TRIED TO KILL BHARATMATA . . PEOPLE LIKE JEW NOAM CHOMSKY GIVE FIATS TO COLLEGIUM MELORDS .. .
    BEFORE 1947 ALMOST ALL OUR JUDGES WERE IN THE PAYROLL OF JEW ROTHSCHILD . . .
    WE KNOW COLLEGIUM JUDGES HAVE FOREIGN SUPPORT WHEN THEIR LEGISTLATE , DO EXTREME JUDICIAL OVERREACH . . . . . . .
    MELORDS GIVE TOP PRIORITY FOR HOM0SEXUALITY , BOLLYWOOD AND CRICKET . . .

    THERE ARE FORCES IN INDIA IN THE PAYROLL OF THE BILDERBERG CLUB TO WEAKEN THE MORAL FIBRE OF INDIAN SOCIETY. .. . . . . . .

    THE ORDERS OF COLLEGIUM JUDICIARY THAT CENSOR BOARD CAN ONLY CERTIFY AS ADULTS ONLY/ FIT FOR CHILDREN IS INDEED VERY DISTURBING .. . . . . . .

    TODAY THE PUNJABI SCHOOL GIRLS ADDICTED TO HEROIN HAVE TO ACT OUT SUNNY LEONE ( ALL THREE 0RIFICES ) TO GET ANOTHER FREE FIX. .. . .
    BIGG BOSS HAS BEEN INTRODUCED IN INDIA TO MAKE INDIAN SOCIETY ACCEPT WEIRDOS / PUNKS / HOMOSEXUALS / CROSS DRESSERS / MISFITS -- AS IF THEY ARE NORMAL PEOPLE . . . . . . .

    BHARATMATA IS RACING TO BE THIS PLANETS NO 1 SUPERPOWER IN 17 YEARS --BEFORE THAT THE NEW WORLD ORDER WANTS INDIA TO IMPLODE. .. . . . . . .

    ALL SEPARATIST / NAXALS / FEMINISTS / DRUGS / ATHEIST COMMIES/ UGLY IS BEAUTIFUL/ DEFYING TEACHER-PARENTS - ARE SPONSORED BY KOSHER FORCES . . . . .

    SUPPORT PAHLAJ NIHALANI-- HIS JOB IS TO CENSOR AND NOT CERTIFY. . .

    PM MODI CAN BE ABUSED LEFT AND RIGHT AND CALLED PSYCHOPATH --THE COLLEGIUM MELORD JUDGE SAID - - IT IS NORMAL - - - BECAUSE THERE WERE NO VIOLENT RIOTS -- . .

    The GRAVE implication is, WE COLLEGIUM JUDGES CONTROL INDIA. . . Almost all media barons run their own foreign funded NGOs and they can trigger violent riots and then get the collegium judge to ACT AND JAIL ANYBODY . . even salman khan for a non-malicious , inadvertent , unintentional RAPE analogy .. . .

    WHEN DID YOU LAST SEE THE BENAMI MEDIA/ COLLEGIUM JUDICIARY/ NEW WORLD ORDER CONTROLLED RAJYA SABHA SUPPORTING THE WATAN ? . .

    IT IS THE JOB OF THE FILM CENSOR BOARD TO SAVE INDIAN SOCIETY FROM DARK THEMES AND IMMORAL DEBAUCHERY. . . .

    AFTER ANURAG KASHYAPs HARAMKH0R MALE TEACHER SEDUCING HIS GIRL STUDENT , WHAT IS NEXT-- FATHER FALLING IN LOVE WITH HIS DAUGHTER ?

    WHERE DOES ALL THIS END ? . .. .

    OUR COLLEGIUM JUDICIARY BURNT MIDNIGHT OIL TO OPEN CHAMIYA BARS ( WH0RE HOUSES IN MUMBAI )

    BREAD WINNERS OF ENTIRE FAMILIES HAVE BEEN ROTTING IN JAIL WITHOUT A TRIAL FOR THREE DECADES .. . . ..
    we the people who are above the constitution will NOT allow lawyers turned judges to play god . . .
    READ ALL 7 PARTS OF THE POST BELOW -
    punch into Google search -- -
    . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .

    capt ajit vadakayil
    ..

    ReplyDelete

  83. ###### SUBJECT- - - COLLEGIUM JUDGES AND NHRC SAVING DESH DROHIS ########

    EVERY TIME OUR UNIFORMED MEN RISK THEIR LIVES AND ARREST TERRORISTS , NAXALS AND SEPARATISTS - -OUR COLLEGIUM MELORDS WHO ARE AFRAID OF JEW NOAM CHOMSKY SAVE THEM . . ..

    WE DO NOT WANT JUDICIARY TO PLAY GOD IN INDIA . .

    INDIA IS THE ONLY NATION ON THIS PLANET , WHERE COLLEGIUM JUDICIARY ELECTS JUDGES . .THEY SCUTTLED NJAC . . .

    BEFORE 1947 ALMOST ALL OUR JUDGES WERE IN THE PAYROLL OF JEW ROTHSCHILD . . .
    WE KNOW COLLEGIUM JUDGES HAVE FOREIGN SUPPORT WHEN THEIR LEGISLATE , DO EXTREME JUDICIAL OVERREACH . . . . . . .

    EVERY TIME DESH DROHI FOREIGN FORCES WANT A NEW LAW IN INDIA, THEY USE THEIR TROJAN HORSE NGOs TO FILE A PIL WHICH STRANGELY IS GIVEN TOP PRIORITY ALONG WITH HOM0SEXUALITY . . . .

    OUR COLLEGIUM JUDICIARY BURNT MIDNIGHT OIL TO OPEN CHAMIYA BARS ( WH0RE HOUSES IN MUMBAI ).....

    BREADWINNERS OF THOUSANDS OF FAMILIES HAVE BEEN AWITING JUSTICE AS UNDERTRIALS FOR DECADES . . .

    BHARATMATA IS RACING TO BE THIS PLANETS NO 1 SUPERPOWER IN 17 YEARS --BEFORE THAT THE NEW WORLD ORDER WANTS INDIA TO IMPLODE. .. . . . . . .

    ALL SEPARATIST / NAXALS / FEMINISTS / DRUGS / ATHEIST COMMIES/ UGLY IS BEAUTIFUL/ DEFYING TEACHER-PARENTS - ARE SPONSORED BY TRAITORS IN THE PAYROLL OF KOSHER FORCES . . . . .

    PM MODI CAN BE ABUSED LEFT AND RIGHT AND CALLED PSYCHOPATH --THE COLLEGIUM MELORD JUDGE SAID - - IT IS NORMAL - - - BECAUSE THERE WERE NO VIOLENT RIOTS -- . .

    The GRAVE implication is, WE COLLEGIUM JUDGES CONTROL INDIA. . . Almost all media barons run their own foreign funded NGOs and they can trigger violent riots and then get the collegium judge to ACT AND JAIL ANYBODY . . even salman khan for a non-malicious , inadvertent , unintentional RAPE analogy .. . .

    WHEN DID YOU LAST SEE THE BENAMI MEDIA/ COLLEGIUM JUDICIARY/ NEW WORLD ORDER CONTROLLED RAJYA SABHA SUPPORTING THE WATAN ? . .

    READ ALL 7 PARTS OF THE POST BELOW -
    punch into Google search -- -
    . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .

    capt ajit vadakayil

    ReplyDelete

  84. ################# SUBJECT-- STUDENTS PARLIAMENT TO DISCUSS ROHIT VEMULA #######################
    STUDENTS PARLIAMENT to drive wedges is the brainchild of BILDERBERG CLUB / NEW WORLD ORDER to make india implode internally . .

    In 1962 Indian commies took money from china and supported the enemy China against their own watan India. . . Before 1960 indian commies took money from Russia . .

    in 1942 QUIT INDIA MOVEMENT indian commies supported britain ( IN WRITING / FOLLOWED UP BY A PRAISE LETTER AFTER BRITAIN CRUSHED THE MOVEMENT ) --while the rest of india fought for the watan. . ..

    WHEN WE MOVE AGAINST TRAITORS-- JEW NOAM CHOMSKY EXERTS HIS STRANGE INFLUENCE ON THE COLLEGIUM JUDICIARY. . ..
    READ ALL 7 PARTS OF THE POST BELOW - ..
    punch into Google search -- -
    . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .


    READ ALL 11 PARTS OF THE POST BELOW -- -

    Punch into Google search - - -
    . . . . . .. .. . JNU , DEN OF ANTI NATIONALS AND COMMUNIST CRIMINALS VADAKAYIL .. . . . . .. .
    capt ajit vadakayil
    ..

    ReplyDelete
  85. WHY IS THE GOVT OF INDIA ALLOWING "DOUBLE AGENT " ARNAB GOSWAMI TO GIVE A PLATFORM TO DESH DROHIS TO AIR THEIR VIEWS ?

    WHY DO WE INDIANS NEED TO LISTEN TO THE VIEWS OF KASHMIRI SEPARATISTS WHO SAY THAT THEY HATE INDIA AND LOVE PAKISTAN ?

    WHY DO WE INDIAN HAVE TO LISTEN TO VITRIOL FROM PAKISTANIS ON NEWSHOUR ?

    MIND YOU ARBAB GOSWAMI PRETENDS TO BE A GREAT DESH BHAKT-- HE IS NOT !

    HE HIS JUST SERVING HIS BENAMI BOSSES .

    IT IS HIGH TIME WE SLAP SEDITION LAWS ON ALL THOSE WHO SPONSOR SEPARATISTS .

    WE THE PEOPLE OF INDIA WANT TRAITORS TO BE PUNISHED SEVERELY.

    ALL THOSE WHO SAY THAT KASHMIR IS NOT PART OF INDIA, CANNOT BE PART OF ANY DIALOGUE

    ReplyDelete
  86. Hi, Captain Sir

    Steven Strogatz: How things in nature tend to sync up

    https://www.youtube.com/watch?v=aSNrKS-sCE0

    Nature is full of divine Sir,people of this planet is Synchronizing for the long buried truth dig out by you.Truth will Prevail

    regards.

    ReplyDelete
  87. src356

    August 11, 2016 at 12:09 PM

    Hello Captain,

    Please take a look. Similar to what you have been saying.
    www.express.co.uk/news/science/693817/Jesus-Christ-HOAX-Biblical-christianity-roman-empire

    ReplyDelete
    Replies

    #############################

    Capt. Ajit Vadakayil
    August 11, 2016 at 1:13 PM

    JESUS CHRIST NEVER EXISTED .

    I HAVE DONE 30 YEARS OF RESEARCH .

    MY GENOME KNOWS ROME

    READ ALL 4 PARTS OF THE POST BELOW--

    http://ajitvadakayil.blogspot.in/2016/04/apollonius-or-jesus-christ-who-is-real.html

    ReplyDelete
  88. http://ajitvadakayil.blogspot.in/2016/07/sanatana-dharma-hinduism-exhumed-and_31.html

    I WANT ALL MY READERS TO READ THE POST ABOVE AGAIN

    BAD DAYS HAVE STARTED FOR SRI SRI RAVISHANKAR . .

    NEXT TIME HE GOES TO SOUTH AMERICA AND A COUPLE OF COUNTRIES IN EUROPE THERE ARE ANGRY PEOPLE WHO WILL GET HIM ARRESTED FOR CAUSING BRAIN DAMAGE DUE TO HYPERVENTILATION ( SUDARSHAN KRIYA- SO HUM )

    ReplyDelete
  89. STOP PRESS :

    kancha ilaih SQUEAK nay shephard came on TV couple of years ago.

    he was cracking up from within-- his voice quivered with sheer grief when he cried--THESE HINDU GODS ARE SO VIOLENT, THEY ARE ALL THE TIME KILLING PEOPLE

    to this SQUEAK i must say " hindus gods are all cosmic allegories except vishnu avatars "

    stop moaning that Brahmins did NOT allow shudras to learn vedas – this would be as irresponsible as a brain surgeon allowing his nurse to do brain surgery on a holiday .. vedas went on the oral route for 300 centuries, without losing a syllable , before they were penned down 70 centuries ago ..

    CONDENSATION DOES NOT KILL EVAPORATION--THIS IS A CONCEPT MEANT FOR THE WISE--NOT IDIOTS.

    http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html
    devdutt pattanaik who does NOT understand sanatana dharama comes on TV serials aand denigrated hindusim.

    he thinks that hindu gods are mortals , and their vahanas ( vimanas ) animals and birds.

    see the way amish tripati converted shiva to be a tribal sex started mortal and the white man loved him for it.

    devdutt pattanaik's attitude towards hinduism can be gauged from the post below--

    read the part n blue italics- where shiva is hiding from nandi bull who is waiting in ambush to rape shiva anally . . . reciprocation if you please . .

    http://ajitvadakayil.blogspot.in/2014/01/nandi-bull-vahana-and-gatekeeper-of.html

    if he did the same in saudi arabia to islam he would have been beheaded on the streets within an hour.

    this blogsite asks TIMES OF INDIA e-newspaper to stop denigrating Hinduism daily vide its SPIRITUALITY COLUMN.

    devdutt pattanaik must know there is no heaven and hell in Hinduism.

    somebody asked me about old people-- even from kerala-- going to KASHI GHATS to die.

    well in olden days due to the saraswati river underground component, there was a MOBIUS COIL water flow at the ghats . people whose souls departs from this massive SCALAR FIELD gets a boost of ONE astral layer

    same with kailash mountain-- pandavas walked to mount kailash before they died.

    pyramid shaped mount kailash has an ORGONE FIELD due to the golden mean of 1.618 .

    http://ajitvadakayil.blogspot.in/2010/12/secrets-of-egyptian-pyramids-revealed.html

    THIS BLOGSITE WARNS JNU COMMIE PROFESSORS, NOT TO COOK UP FALSE STORIES ABOUT SANATANA DHARMA . .

    WE DONT WANT COMMIES TO SAVE INDIA..

    capt ajit vadakayil
    ..

    ReplyDelete
  90. Maxmad
    September 2, 2016 at 6:02 PM

    Captain,before mongols invaded who was the ruler in Tibet ?
    Delete

    ###########################

    Capt. Ajit Vadakayil
    September 2, 2016 at 6:34 PM

    TIBET WAS PART OF INDIA AS LATE AS THE MAHABHARATA WAR IN 4000 BC , WHEN TIBETANS SIDED WITH KAURAVAS.

    INDIA RULED AS FAR NORTH AS URALS IN 7000 BC

    http://ajitvadakayil.blogspot.in/2011/12/stonehenge-of-arkaim-russia-capt-ajit.html

    JEW ROTHSCHILDs HISTORIANS CREATED A FAKE KING BHARAT, USING HIS FAKE AND BACKDATED DASAS.

    IT IS FUCKIN' LIE THAT KING BHARAT WAS SON OF THE FAKE AND BACK DATED SHAKUNTALA

    WE IN INDIA NEVER HEARD OF SHAKUNTALA TILL THE WHITE INVADER CAME TO INDIA.
    KALIDASA LIKE EVERY OTHER DASA NEVER EXISTED .

    http://ajitvadakayil.blogspot.in/2013/06/kalidasa-did-not-exist-jainism-is.html

    THE REAL EMPEROR BHARATA WAS THE SON OF EMPEROR RISHABA -- HE RULED TIBET .

    SVAYAMBHUVA MANU ( 8275 BC ) — PRIYA VARTA ( 8255 BC )- AGNIDHARA – NABHI RAJA -- RISHABHA (8190 BC ) – BHARATA ( 8165 BC ) .

    Emperor Rishabha ( Adinath ) , the father of Chakravatri Bharata is the founder of Jainism in 8190 BC, and is the first Thirthankara.

    IF CHINA ACTS TOO FUNNY , WE WILL SNATCH BACK TIBET .

    capt ajit vadakayil
    ..

    ReplyDelete
  91. he Benami media have got instructions from their foreign masters to praise Mother Teresa , as she will be made a saint tomorrow . .

    Even PM Modi will jump into the bandwagon .. .

    Karo bhaiyya , make this evil woman a god , who cares ? ..

    http://ajitvadakayil.blogspot.in/2011/02/diabolical-ministering-angel-mother.html

    CHRISTIANITY IS ROOTED IN FOUL LIES . . .

    http://ajitvadakayil.blogspot.in/2015/10/true-founder-of-christianity-jesus.html

    This religion has destroyed mankind and killed maximum people . .

    http://ajitvadakayil.blogspot.in/2016/03/st-patrick-genocide-of-druids-pope-leo.html

    KARO BHAIYYA !

    Know the truth how Christianity was spread on this planet . .

    http://ajitvadakayil.blogspot.in/2012/07/fransisco-pizarro-hernan-cortez.html

    http://ajitvadakayil.blogspot.in/2013/01/christopher-columbus-father-of-american.html

    capt ajit vadakayil
    ..

    ReplyDelete