Tuesday, August 2, 2016

SANATANA DHARMA , HINDUISM EXHUMED AND RESURRECTED, PART 61 - CAPT AJIT VADAKAYIL


THIS POST IS CONTINUED FROM PART 60, BELOW---


http://ajitvadakayil.blogspot.in/2016/08/sanatana-dharma-hinduism-exhumed-and.html


NONE OF THE SO CALLED ANCIENT CIVILIZATIONS OF THE PLANET HAVE LEFT BEHIND ANYTHING OF CEREBRAL VALUE IN WRITING-- ABSOLUTELY  NOTHING !!     

80% OF OUR VEDAS ( SAMHITAS/ BRAHMANAS/ ARANYAKAS/ UPANSIHADS) HAVE BEEN STOLEN / DESTROYED BY THE WHITE INVADER.    

THE JEALOUS WHITE MAN  POST DATED OUR ANCIENT WORKS PENNED DOWN IN 5000 BC,   TO SUIT THEIR UNDERSTANDING OF BIG BANG DATED AT A RIDICULOUS 4004 BC.    

IN THIS INTERNET AGE, IT IS PAY BACK TIME !   


THE WORLD SHALL KNOW THE GLORY OF ANCIENT INDIA  !! 





CHECK OUT THE SOUND OF  PATANJALIs YOGA SUTRAS PENNED DOWN 7000 YEARS AGO, WHEN THE REST OF THE WORLD WERE RUNNING AROUND NAKED DOING GRUNT GRUNT

http://ajitvadakayil.blogspot.in/2015/01/yoga-only-complete-exercise.html

http://ajitvadakayil.blogspot.in/2015/01/yoga-only-complete-exercise-part-2-capt.html


CHAPTER I-  SAMADHI PADA-   CONTEMPLATION
atha yoganushasanam
yogashchittavrittinirodhah
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pramannaviparyayavikalpanidrasmritayah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
vitarkavicharanandasmitaroopanugamatsanprajnatah
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tajjapastadarthabhavanam
tatah pratyakchetanadhigamopyantarayabhavashch
vyadhistyanasanshayapramadalasyaviratibhrantidarshanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah
duhkhadaurmanasyanggamejayatvashvasaprashvaavikshepasahabhuvah
tatpratishedhartham ekatattvabhyasah
maitreekarunamuditopekshanansukhaduhkhapunyapunyavishayananbhavanatashchittaprasadanam
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
ksheennavritterabhijatasyevmanergrahitrigrahannagrahyeshutatsthatadangjanatasamapattih
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih

CHAPTER II - SADHANA PADA-- PRACTISE

tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
anityashuchiduhkhanatmasunityashuchisukhatmakhyatiravidya
drigdarshanashaktyorekatmatevasmita
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
dhyanaheyastadvrittayah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
samadhisiddhirishvarapranidhanat
sthirasukham aasanam
prayatnashaithilyanantasamapattibhyam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah

CHAPTER III – VIBHOOTI PADA - MANIFESTATION

deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
sarvarthataikagratayoh
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
parinamatrayasanyamadatitanagatajnanam
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
sthoolasvaroopasookshmanvayarthavattvasamyamadbhootajayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti

CHAPTER IV--  KAIVALYA PADA --  LIBERATION

janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
nirmannachittanyasmitamatrat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
chiterapratisankramayastadakarapattausvabuddhisanvedanam
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah
purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti



3.02 - - - tatra pratyayaikatanata dhyanam


A balanced, continuous flow of attention directed towards the same point or region is meditation (dhyana). 


The distinguishable feature of meditation (dhyana) is the sustenance of a continual flow of attention on a fixed point or region, without interference or interruption. In dhyana, psychological and chronological time come to a standstill as the mind observes its own behaviour. The strength of attention in the field of consciousness neither alters nor vacillates, remaining as stable, smooth and constant as oil being poured from a jug. Upholding the same strength of awareness, the attentive awareness moves from one-pointed concentration to no-pointed attentiveness. The dissimilarity between dharana and dhyana is that dharana is more concerned with the elimination of fluctuating thought-waves in order to achieve single-pointed concentration; in dhyana, the emphasis is on the maintenance of steady and profound contemplative observation. Ekatanata connotes an unbroken flow of contact between the sadhaka's consciousness and his sadhana. It can thus be seen that dhyana may be achieved in both asana and pranayama. In asana, there is a centrifugal movement of consciousness to the frontiers of the body, whether stretched vertically, horizontally or circumferentially, and a centripetal movement as the whole body is brought into single focus. If attention is steadily maintained in this manner, meditation takes place. Likewise, in pranayama, the flow of in- or out- breath is considerately measured and sustained, resulting in complete involvement with the self. During retention, when the breath, cells of the torso, consciousness and soul are brought into unison, meditation happens. In short, when attention, reflection and contemplation in action and observation are steadily sustained, dharana evolves into dhyana. The key term in this verse is pratayaya. Pratayaya,  is an auxiliary cause, as distinguished from a direct cause (hetu). A seed, for example, is a direct cause of a plant, while sunshine, water, and earth are auxiliary causes of a plant. Mind is an inseparable part of the human being. It is distinct from brain, nervous system; it is distinct from all other physical organs, it is distinct from Pranic Force behind body activities. The mind is distinct from all these systems but at the same time, it is closely associated with all these systems of the body. Mind is very difficult to access directly but all these systems are relatively easier to access. So mind can be accessed through these systems.People have not been clear about dharana and dhyana. Both are not the same. Dharana is the contact, and dhyana is the connection. Dharana, which means "holding on", is the focusing and holding one's awareness to one object for a long period of time. Dhyana is contemplating, reflecting on whatever Dharana has focused on. Dharana must precede dhyana, because the mind needs focusing on a particular object before a connection can be made.. People frequently confuse concentration with meditation. In concentration, there is a subject and an object. You, the subject, are concentrating on a the bindu of Sri yantra  candle, or an image of ishtadevata  or the tip of your nose. These are objects of concentration. In meditation, the object disappears. The subject disappears. All becomes one. Rather than focusing on a mantra, you and the mantra become one. In meditation, all borders, boundaries, and separation between ourselves and the universe begin to disappear. We begin to realize the inherent oneness of all beings and all of creation. Dhyana is contemplation. If the concentration was on one object, Dhyana is non-judgmental, non-presumptuous observation of that object. Dhyana is uninterrupted train of thought, current of cognition, flow of awareness.   In Patanjali's Raja Yoga, dhyana is "a refined meditative practice" a "deeper concentration of the mind", which is taken up after preceding exercises such as mastering pranayama (breath control) and dharana (mental focus). Dhyana is integrally related to Dharana, one leads to other. Dharana is a state of mind, Dhyana the process of mind. Dhyana is distinct from Dharana in that the meditator becomes actively engaged with its focus.   4000 years ago, Adi Shankaracharya, in his commentary on Yoga Sutras, distinguishes Dhyana from Dharana, by explaining Dhyana as the yoga state when there is only the "stream of continuous thought about the object, uninterrupted by other thoughts of different kind for the same object"; Dharana, states Shankara, is focussed on one object, but aware of its many aspects and ideas about the same object. Shankara gives the example of a yogin in a state of dharana on morning sun may be aware of its brilliance, color and orbit; the yogin in dhyana state contemplates on sun's orbit alone for example, without being interrupted by its color, brilliance or other related ideas. Dhyana is the continuous flow of the same thought or image of the object of meditation, without being distracted by any other thought.  When the mind has been trained to remain fixed on a certain internal or external location, there comes to it the power of flowing in an unbroken current, as it were, towards that point, this state is called Dhyana. While Dharana was the stage in yoga where the yogi held one's awareness to one object for a long period of time, Dhyana is concentrated meditation where he contemplates without interruption the object of meditation, beyond any memory of ego or anything else. Dhyana is distinct from Dharana, in that the yogi contemplates on the object of meditation and the object's aspects only, free from distractions, with his mind during Dhyana. With practice, the process of Dhyana awakens self-awareness.. Let me jump the gun a bit-- when one has so intensified the power of dhyana as to be able to reject the external part of perception and remain meditating only on the internal part, the meaning, that state is called Samadhi. Patanjali distinguishes between Dharana which is effortful focusing of attention, Dhyana which is easy continuous one-pointedness, and Samadhi which is absorption, ecstasy, contemplation. A person who begins meditation practice, usually practices Dharana. With practice he is able to gain ease in which he learns how to contemplate in a sharply focussed fashion, and then "he is able more and more easily to give uninterrupted attention to the meditation object; that is to say, he attains Dhyana". With further practice, the yogi "ceases being detachedly vigilant" and enters "a state of fusion with the meditation object" which is Samadhi. Dhyana is contemplating, reflecting on whatever Dharana has focused on. Dhyana Yoga is the union of the individual self with the universal self. Yogic science does not demarcate where the body starts and the mind begins, but approaches both as a single, integrated entity. . If the concentration was on one object, Dhyana is non-judgmental, non-presumptuous observation of that object. If the focus was on a concept/idea, Dhyana is contemplating that concept/idea in all its aspects, forms and consequences. Dhyana is uninterrupted train of thought, current of cognition, flow of awareness. Contemplation is of three kinds: material (sthula dhyana), luminous (jyotir-dhyana) and subtle (sukshma-dhyana). (a) In "material contemplation", the image of a deity is thought of. (b) In "luminous contemplation", the radiance of Divinity or of Nature (Prakriti) is pondered. (c) In "subtle contemplation", the mind is concentrated on the point-limit (bindu) where the unmanifest becomes manifest, or on the basic coiled energy, kundalini. Contemplation is of two kinds, either on a perceptible form (sa-rupa) or without a perceptible form (a-rupa). Contemplation without a perceptible form is beyond the grasp of words and mind, it belongs to the unmanifest, is all-pervading and cannot be pointed to as 'this' or 'that'. It is only through a long process of identification that yogis can cognize it. 'Dhyana is the study of deep concentration, calmness and tranquility of the mind. It is the study of attaining complete control over ones mind. Meditation takes the consciousness beyond conscious, sub conscious and unconscious states to super consciousness. We all know that our mind is fickle, like a butterfly, which always flies from here and there and does not wait at one place for long. But the speed of our mind is far more than the butterfly or it is greater than the speed of light. Mind can recollect past experiences, keeps thinking about the future and experiences the present with all its might and we do not have any control over our minds journey. Mind has no physical existence. Existence of the mind can't be denied. The nature of the mind is to move from one point to another continuously. The mind has tremendous speed.. Mind doesn't remain stable at any particular point or any object. It keeps moving all the time. Mind runs after the objects it likes but runs away from the objects that it dislikes.You have already studied that the mind is essential in the process of acquiring knowledge. For example when you are listening to a speaker in lecture, you learn through your ears. But if your mind is not concentrating on the lecture then you won't understand anything there. As the mind is unstable, you cannot concentrate on lecture. So to learn what the speaker is telling, you must establish control over your mind and force it to listen to the lecture. Then only you'll be able to acquire knowledge. Hence you have to control movements of mind and make it stable whenever you want, as per your requirements. But this is the most difficult part because of unstable nature of mind. This process of making mind stable is called concentration.. If you want to remember a particular event, you will have to concentrate your mind till you remember that event. Only then, one can get what he wants. But controlling mind is the most difficult task. Efforts are being continuously made to find out the ways and means to establish control over mind. Meditation is one of the very effective ways to control the mind. This control can't be achieved in short period.  Meditation is a systematically designed technique to achieve this step by step.In Dhyana Yoga, it is important to remember three things:  one-pointedness of mind – controlling its movements; setting bounds to one’s life to help achieve this – doing actions after weighing and measuring them; and state of level-headedness or evenness of vision – having the nobility to think in terms of the whole world.  A true yoga teacher is not one who merely instructs verbal cues or gives theoretical knowledge, but also one who guides and teaches mentally, spiritually and physically.  The very basic of a yoga class is adjustments and lifestyle intervention, if a teacher does not engages in such, he is just a mundane physical instructor.  Dhyana ensures that one does not grow with ego, the sense of self and feeling of being superior, no matter how much achievement you unlock. Practicing Dhyana Yoga allows the practitioner to calm his mind and allow him to look in the outside world without distractions. In doing so, he is able to reach a heightened level of awareness. Dhyana will help us to gain awareness of the happenings and ensure that we ultimately reach true bliss, but not indulge in momentary pleasures.  Dhyana involves concentration upon a point of focus with the intention of knowing the truth about it. During dharana the mind is moving in one direction like a quiet river-nothing else is happening. In dhyana, one becomes involved with a particular thing - a link is established between self and object. In other words, you perceive a particular object and at the same time continuously communicate with it.  Each time the mind evades you, runs here and there and you bring it back, that is called concentration. Concentration is trying to fix the mind on one thing. Meditation is when you have tried and are successful.   To focus the attention to one point will not result in insight or realization. One must identify and become "one with" the object of contemplation, in order to know for certain the truth about it. In dhyana, the consciousness of the practitioner is in one flow; it is no longer fixed on one subject as in dharana. Vedanta holds that, since the universal divine Self dwells within the heart, the way to experience and recognize divinity is to turn one's attention inward in a process of contemplative meditation. Adi Shankaracharya  dedicates an extensive chapter on meditation, in his commentary on the Brahma-sutras. The mind is like a lake, and stones that are dropped into it (or winds) raise waves. Those waves do not let us see who we are. (...) The waters must be calmed. If one remains quite, eventually the winds that ruffle the water will give up, and then one knows who one is. God is constantly within us, but the mind obscures that fact with agitated waves of worldly desires. Meditation quiets those waves (Bhagavad Gita V.28). 

There are different forms of Dhyana Yoga. The aim is to withdraw all senses from various objects of interest and focus on one object. Dhyana Yoga produces a state of tranquility. Its objective is to cleanse the subconscious, develop concentration, clear the mind, and bring about various stages of unified communion with God. The most important aspect for a successful meditation practice is regularity. The best time for practice is early morning. The great yogis recommend we practice during Brahmamuhurta, or the hours between 4 and 6 am. Find a quiet undisturbed place in your house to meditate and set up an inspiring and vibrationally uplifting meditation space or altar. If possible you should try to find a place that no one else will disturb -It is common practice to set on the altar some photos of your main deity, or the Om symbol.  Many people cover the altar with a pleasing colour cloth and keep there fresh flowers, incense, oil lamp, and one or several deity figures. To be able to meditate well you have to be able to sit comfortably. Try to find a good, comfortable cross-legged posture. Your posture should be very steady and easy to maintain. The back should be straight to balance  the spirit level inyour inner ear cochlea. and the whole body should be as relaxed as possible. Generally you should keep your hands on the knees or folded together in front of the body to help preserve energy. Try not to move. Keep your eyes closed unless you are practicing tratak (steady gazing). At this point it can be helpful to repeat the mantra OM several times, at first out loud and then gradually mentally. It will help to calm the mind in preparation for the remaining steps. Now that you are comfortably in your steady posture in your meditation space, you should make a sankalpa, or resolve, commanding the mind to be quiet for a specific length of time – this will give a powerful instruction to the subconscious mind. The resolve could be, ‘I will keep my mind quiet for 20 minutes’, or ‘I will meditate 15 minutes’. Whatever you choose for your sankalpa be sure to finish the resolve to give strength to the mind and set up a good pattern for your practice. It is important at this stage not to force the mind to be still. If you try to force it too much it will rebel, making your practice even more difficult. Be patient and persevere.. Work with your mind, not against it. Try to be a witness of the extraneous thoughts, not being affected by them, but letting them go by as though you are just watching and not engaging with them. This stage can be very difficult, but with proper patience and diligence can be overcome. Calm the bubbling emotions, sentiments, instincts and impulses through silent meditation. Once your mind starts to calm down you should select a focal point, or lakshya, to concentrate on. This is usually either the place between the eyebrows (ajna chakra), or in the heart center in the middle of the chest (anahata chakra). Center your mind in that point, concentrating all of your prana (energy) and attention at that place. As an aid to concentration, it can be helpful to envision in your lakshya a bright white light or your main deity, or OM symbol or the Bindu of Sri Yantra. Usually people will choose the space between the eyebrows and more emotional people will choose the heart center. Once you determine your focal point you should never change it.  The last step is to concentrate on a mantra. This becomes your main object of concentration. Everything else should just be in the background of your mind. Keep repeating the mantra until you become totally immersed in it. You should coordinate the correct repetition of the mantra on the inhale, and the correct repetition of the mantra on the exhale. Some people don't have a mantra, and it is acceptable for them to use the universal mantra OM. In dharana, the mind is put through various rigors of trainings to restrain its waywardness and to refine its awareness to the ultimate degree of ‘one-pointedness’. Achieving this state is an ‘active process’ that requires much effort. But it is precisely when this ‘one-pointedness’ of mind ceases to be an ‘active effort’ and then just ‘happens naturally’, without any effort, that we have achieved the state of meditation.… notice that I refer to meditation as a ‘state’ (of being, or of mind), and not a techinique that we ‘practice’. So dhyana, as far as it can be described with words, is an unbroken stream of concentration, whereby very little ‘sense of self’ remains. At this level, it becomes increasingly more difficult to use words and the reasoning, conscious mind to describe the experiences of yoga. After all, the state of meditation, by its very nature transcends our material human experience and everything that is related to it. We could say that meditation (dhyana), is concentration (dharana) taken to ‘perfection’ — In other words, a meditative state is the natural result of ‘perfect concentration’. So it is prolonged concentration, then, that leads the sadhaka into this ‘spontaneous’ and ‘free-flowing’ meditative state, whereby nothing but the object of concentration fills the mental space; and whereby the observer and the observed merge into one. We could also say that it is the occasional appearance of ‘distractions in the mind’ that constitutes the essential difference between dharana and dhyana.  Meditation is an exalted state of being which is produced by a moral and ethical, pure lifestyle; control of the body and breath through Asana and Pranayama; transcendence of and freedom from the imprisonment of the senses in Pratyahara. Practices of Dharana, exercises in concentrating and focusing the mind must be perfected. Only then is one able to even speak of meditation, let alone experience it. Prayer is NOT meditation. The former is a petition to  God, and the other is a detached observation of one's own mind, and its processes. In the modern world, meditation is used as a non-religious technique for relaxation and stress reduction for long-term psychological improvements. Meditation is done to purify the mind and gain insight.  It abstracts the self from conscious thought, and frees the mind from feelings that cause stress and suffering.   It fosters creative intelligence, raise consciousness, and enables fuller use to be made of mental potential. The spiritual aims are peace of mind, wisdom, and, ultimately, a state of enlightenment or self-realization.  It is a  form of natural healing, and helps people cope with  anxiety, depression, and drug dependence. The attention is focused on monitoring the breath, and noting thoughts crossing the mind, without any judgement or attempt at control, but as a silent and detached witness.  If the mind throws up distractions, the meditator returns to simply observing the breath each time the distraction happens.  A relaxed and unhurried attitude is important, since slowing down and observing the mind to see how it works is central to the philosophy behind meditation. Using the mantra technique, the meditator concentrates on a mantra  to banish intrusive thoughts and thus achieve progressively quieter levels of thinking until thought itself is transcended. The subtle vitalizing frequencies of mantras activate psychic energies and awaken our intuitive faculties.  Sonic frequencies interact with our cellular vibration levels and assist in maintaining a healthy resonant frequency in our bodies. Mantras still the activity of thought and helps you find a deeper level of consciousness. Meditation brings peace and allows us to raise our vibrational level.  Digestion grounds us. Hence eat only after  the meditation session.  Eating engages the body’s digestive system , thus returning the body’s vibrational level back to normal. During meditation thinking is separated from perceiving, so that the individual can stand apart from the emotional self.  The reason why people remain mired in negativity is because of the beliefs they have inherited over time. Beliefs are subconscious. We act in the way we do because we are not aware of our beliefs and the feelings that these beliefs generate. That is why it is important to obeserve yourself and look within. We can do it. That is why we are different from animals. We can use our  conscious mind to observe ,to introspect and dip into the  subconscious where our beliefs are embedded , in order to eliminate it.  You can meditate to rewrite these negative programmes  that cause you misery. To be a mystic or a seer is not the same thing as being a spectator on the fence.  Mysticism provides an escape from a life of uninspired existence. It magnifies man and gives him a hope and destiny to fulfill. In the modern era the road to holiness necessarily passes through the world of action. A Mystic who is not of supreme service to the Society -- AINT NO MYSTIC AT ALL.  -- Meditation is an exercise of the mind. What physical exercise is to the body, meditation is to the mind. Silencing the body is easy, but silencing the mind is difficult in this modern age. Silencing is about grace, harmony and tranquility. Exhaustion is NOT tranquility. In the modern age people get stressed, and they need to still the mind--the chattering monkey, which remains entangled in the past and the imagined future, but never in the present.  Meditation is about holding your mind to the present. It is the search for inner strength. It is NOT a drill. It has to be done with grace. Your mind cant keep going round and round in circles, etching a deep groove and make the subject deep rooted. Beware of the spiritually arrogant, such persons cant be proper Gurus. A person stops thinking either when he is dead or when he has realised. When your ego powered mind is chattering like a monkey or the angry sea, you miss the truth. Truth can be communicated only in silence. For this deep silence you need to have harmony between the mind, body and soul. The aim of every form of meditation is to still the mind, or you cant purify it and get rid of deep rooted negativities , which affect your health and even give you severe migraines.  Meditation is a surgical operation of your subconscious mind to remove and discard negativity / ego and improve tolerance, grace and kindness.  Yoga uses the awareness of breath method. The meditator sees the cosmos as nothing but the tiniest packet of quantum energy. It makes you a watcher and a witness. Such a person cannot be an egoist. The art of observing is to help you feel separate from all that you are clinging to. For a layman-- you are stressed when your hands feel cold, your heart rate, breathing, and muscle tension increases. The result is that your immune system goes for a toss and you get depressed or burnt out.. Depression is a weird feeling of loss . Meditation teaches you to look inwards, with awareness , withing yourself and know the true nature of all sensations, and loosen the stranglehold of habits and vices.. he scans his own body and sees where the stress and tension is. He just witnesses , he does not react. His mind does not control him, rather he controls his mind. It is a universal remedy for all universal ills. Find a quiet place to sit for 15 minutes. place where you can sit comfortably, undisturbed, for at least 20 minutes. Background noises like the sound of a car horn or a ticking clock should not be considered hindrances, and in fact can be legitimate objects of mindfulness. Don't wear earplugs .  Wear loose clothing  and be bare feet. Sit with your back and head held straight. You may sit on the floor or in a chair. Keep your eyes closed. If you must move, notice how and why you are moving.  Simply be mindful of in-and-out breathing. You may feel that your breathing is too short, too long, too gentle or too heavy. Do not try to control it. Stop judging. Just let it be, let it settle by itself as you watch.  It is the process of watching which is the meditation, not what you are watching.  When you become distracted, gently refocus your attention on your breathing. Keep watching. Just breathe... As the abdomen rises, observe the motion from beginning to end with your mind. When the abdomen falls, do the same. That's it. Just keep watching the rising-falling movements. You don't have to do anything to them. Just know the movements without judging or describing them.  Restrict your attention to what is occurring in the immediate present moment. Don't think about the past or future— don't think about anything at all. Let go of worries, concerns, and memories. Empty your mind of everything except the movements occurring right now. But don't think about the motions; just know them.In insight meditation the aim is not to think, but only to know. As the abdomen expands, say the word "rising" in your mind. When it contracts, say "falling." Continue to note rising, falling, rising, falling, from one moment to the next. Ninety-percent of your attention should be on the actual movement instead of on the label. The aim in meditation is to know the object itself, not the word.  The abdomen should not be visualized. You only have to know the movements. Be sure to breathe naturally; don't try to control the breath in any way. A mental note identifies the object in general but not in detail. For example, when a sound pulls your attention away, label it "hearing" instead of car horn," "voices" or "barking dog." If an unpleasant sensation arises, note "pain " or "feeling" instead of "knee pain" or "my back pain." Then return your attention to the primary object. When aware of a fragrance, say the mental note "smelling" for a moment or two. You don't have to identify the scent. The motto is: "Focus and forget it," or "know and let go."Healing is NOT a physical process, rather it is mental. Mind can wipe mistakes off the DNA blueprint and destroy any disease that has disturbed the design. DNA's ability to repair itself is affected adversely when a person is in depression. Meditation experiences silence, and is devoid of drives, wishes, fears , thoughts and emotions. Afterwards when the mind returns to its usual level of consciousness, it has acquired some freedom to move.. Grace and peace are the hallmarks of a healthy non-delusional mind in a healthy body.. The happiness is stable.There is NO medicine for jealousy, fear, greed and other toxic negativity.  Only Yoga can save. Although there is a notable separation between dharana (concentration) and dhyana (meditation) in yogic philosophy, there is also an intimate connection between the two. The ancient Vedic  Indian psychology has a  fourfold scale, which represents the degrees of the ladder of being by which man climbs back to the source, the absolute divine. The change, from “here” to “there,”  is not an uneventful process at all.  There come dry periods, deviations, violent alterations, and temptations. If there are raptures and azure heavens, there are anaconda agonies and absolute abandonments, howling hot deserts and “dark cold nights of the soul” to go through. Streaming tears of joy, horripilation (bristling of the hair), stigmata (bodily marks or pains), and parapsychological phenomena have been known to develop. The first stage of meditation  achieves detachment from sensual desires and impure states of mind through analysis and reflection and thereby attains an emotional state of satisfaction and joy. In the second stage, intellectual activities are abated to a complete inner serenity; the mind is in a state of “one-pointedness” or concentration, joy, and pleasantness. In the third stage, every emotion, including joy, has disappeared, leaving the meditator indifferent to everything while remaining completely conscious. The fourth stage is the abandoning of any sense of satisfaction, pain, or serenity because any inclination to a good or bad state of mind has disappeared. The meditator thus enters a state of supreme purity, indifference to everything, and pure consciousness. There were no bounds to the magical powers that can be attained by great Hindu ascetics and yogis  teaching the suppression of all activity of mind, body, and will in order that the self may realize its distinction from them and attain liberation.
“Whatever great thing is known to men is known through meditation … the whole earth, middle space, the heaven, waters and even mountains are engaged in Dhyana”. ~ Chandogya Upanishad 5000 BC





3.03--   tad evarthamatranirbhasan svaroopashoonyam iva samadhih



When the object of meditation engrosses the meditator, appearing as the subject, self-awareness is lost. This is samadhi.




When the attentive flow of consciousness fuses with the object of meditation, the consciousness of the meditator, the subject, appears to be dissolved in the object. This union of subject and object becomes samadhi. When the object of contemplation shines forth without the interference of one's own consciousness, dhyana flows into samadhi.  When a musician loses himself and is completely enwrapped in his music, or an inventor makes his discoveries when devoid of ego, or a painter surpasses himself with colour, shade and brush, they glimpse samadhi. So it is with the yogi - when his object of contemplation becomes himself, devoid of himself, he experiences samadhi. The dissimilarity is that the artist or musician arrives at this state by effort, and cannot sustain it; while the yogi, remaining devoid of ego, experiences it as natural, continuous and effortless. Therefore it is difficult for an artist to instill his vision of the sublime, which is associated with the performance and realisation of a particular art form, into his common daily existence. For the yogi, however, whose 'art' is formless and whose goal has no physical expression like a painting, a book or a symphony, the fragrance of samadhi imbues every aspect of his 'normal' behaviour, activities and state of being. 
Uninterrupted flow of attention dissolves the rip between the object seen and the seer who sees it. Consciousness appears to have ceased, and to have reached a state of silence. It is devoid of 'I', and unites into the core of the being in an unfathomed state of serenity. In samadhi, awareness of place vanishes and one ceases to experience space and time. When the object of meditation engulfs the meditator, appearing as the subject, self-awareness is lost. This is samadhi. 



These verses in the video below  were penned by Adi Shankaracharya 4000 years ago at the age of  eight.  

He was the last of the 12 strand DNA NIL junk – king sized pineal gland maharishis.  

Adi Shankaracharya is beyond prizes from mere 2 strand DNA , 97% junk, shriveled / calcified pineal gland  mortals like me - 
--still I shall give him the VADAKAYIL PRIZE.  

The world is a rich place because of the great soul.


ADI SHANKARACHARYA ( 2000 BC ) GETS THE VADAKAYIL PRIZE.   THIS PRIZE IS NOT WORTH A GREAT SOUL LIKE HIM--    STILL LET IT BE !

HERE IS THE THE LIST OF MAHA MERUS WHO FOOLED THE WORLD , WHOM I HAVE TRASHED INTO THE GARBAGE BIN OF THE PLANET.

GARBAGE BUCKET LIST:

1) BERTRAND RUSSEL
2) ROMILA THAPAR
3) IRFAN HABIB
4) NOAM CHOMSKY
5) RAMCHANDRA GUHA
6) SHELDON POLLOCK
7) SIGMUND FREUD
8) GEORG WILHELM HEGEL
9) AMARTYA SEN
10) WENDY DONIGER
11) FREIDRICH WILHELM NIETZSCHE
12) IMMANUEL KANT
13 ) BARUCH SPINOZA
14) ALBERT EINSTEIN
15) ISAAC NEWTON
16) GUGLEILMO MARCONI
17) CHARLES DARWIN
18) KARL MARX
19) MAX WEBER
20) THOMAS ALVA EDISON
20) FIBONACCI

NOTE: MENTAL MIDGETS LIKE ROMILA THAPAR , IRFAN HABIB , RAMACHANDRA GUHA, SHELDON POLLOCK, WENDY DONIGER MUST BE THANKFUL THAT THEY ARE INCLUDED AMONG A LIST OF CEREBRAL GIANTS

#########################

HERE ARE PEOPLE WHO MADE A DENT IN THE UNIVERSE— THEY GET THE "VADAKAYIL PRIZE". THIS IS NOT A VESTED “NOBEL PRIZE “

1) NIKOLA TESLA
2) DIMITRI MENDELEYEEV
3) IE IRODOV
4) ARYABHATTA
5) SRINIVASAN RAMANUJAN
6) CHANAKYA
7) ADI SHANKARACHARYA

capt ajit vadakayil
..


Mano Buddhi Ahankara Chitta Ninaham
Nacha Shrotra Jihve Na Cha Ghrana Netre
Nacha Vyoma Bhoomir Na Tejo Na Vayu
Chidananda Rupa Shivoham Shivoham

Na Cha Prana Samjno Na Vai Pancha Vayu
Na Va Saptadhatur Na Va Pancha Koshah
Na Vak Pani Padau Na Chopastha Payu
Chidananda Rupa Shivoham Shivoham

Na Me Dvesha Ragau Na Me Lobha Mohau
Mado Naiva Me Naiva Matsarya Bhavah
Na Dharmo Na Chartho Na Kamo Na Mokshah
Chidananda Rupa Shivoham Shivoham

Na Punyam Na Papam Na Saukhyam Na Dukham
Na Mantro Na Teertham Na Vedo Na Yajnaha
Aham Bhojanam Naiva Bhojyam Na Bhokta
Chidananda Rupa Shivoham Shivoham

Na Me Mrityu Shanka Na Me Jati Bhedah
Pita Naiva Me Naiva Mata Na Janma
Na Bandhur Na Mitram Gurur Naiva Shishyah
Chidananda Rupa Shivoham Shivoham

Aham Nirvikalpo Nirakara Roopaha
Vibhur Vyapya Sarvatra Sarvendriyanam
Sada Me Samatvam Na Muktir Na Bandhah
Chidananda Rupa Shivoham Shivoham


I am not this mind, nor intellect, ego or consciousness,
Nor the Gyāna Indriyas or the Tattvas.
My form is pure consiousness and absolute bliss
I am CHIDĀNANDA RŪPA SHIVA, the Supreme Self.

I am neither the five Prānas nor the seven Dhātus,
Nor the five Koshas, nor this bundle of Karmas
I am CHIDĀNANDA RŪPA SHIVA, the Supreme Self.

In me exists neither attachment nor duality,
Neither greed nor jealousy, neither hate nor anger.
I have nothing to do with the illusion of the ego,
And also I am not bound by the four laws of the Purushārtha
I am CHIDĀNANDA RŪPA SHIVA, the Supreme Self.

I have neither sin nor virtue, nothing to do with either happiness or sorrow,
Or with Mantras, pilgrimages, the Vedas or ceremonies
I am neither the food, nor the one nourished, nor the enjoyer
I am CHIDĀNANDA RŪPA SHIVA, the Supreme Self.

I am the Ātmā, immortal and unborn
Time, space and death have no power over me
I have neither father nor mother, neither relatives nor friends
No Guru and no student
I am CHIDĀNANDA RŪPA SHIVA, the Supreme Self.

I am desireless and formless.
I exist in all living beings
I am not bound, nor require liberation
My form is truth, consciousness and bliss

I am CHIDĀNANDA RŪPA SHIVA, the Supreme Self.


Today , I will format Sanatana Dharma.  

I am shooting down all nonsense about Samadhi which FAKE gurus have peddled over the years .  

Why is Sabarimala this planets no 1 pilgrimage ? 

Because it gave pilgrims who observed Makaravilakku , samadhi-- albeit a fleeting experience .   

Modern scientists cant explain this priceless feeling-( ONLY FOR THOSE WHO DID THE 41 DAY VRAT )  

It is akin to spiritual ecstasy in which consciousness leaves the body , while soaked in an ocean of consciousness .  

All it took was about 9 seconds of PURE AWARENESS beyond the clutches of the mind-- between the second and third flash.   

In samadhi, the process of concentration, the object of concentration, and the mind that is trying to concentrate or meditate all have become one. 

The little gap between two thoughts is nothing but Pure Awareness.





IMPORTANT:   SAMADHI  BY KUNDALINI RAISE , AND SUBSEQUENT MOKSHA ,   IS OBTAINED ONLY BY PEOPLE WHOSE KARMIC BAGGAGE IS VERY LITTLE AND APPROACHING ZERO.    


BEWARE OF ROGUE GURUS WHO  SNATCH SPIRITUAL POWER ,  THE IGNORANT FAKES WHO COME ON  BENAMI TV  GHADI GHADI ,  WHO CRAVE THE LIMELIGHT,   WHO SET FAALTHU GUINNESS BOOK OF WORLD RECORDS ,  WHO PROPAGATE ROTHSCHILDs FAKE CHITPAVAN JEW GODS OF PANDHARPUR,  WHO SPEAK AT UN / FREEMASON SEMINARS , OPPORTUNISTIC BASTARDS WEARING JESUS CHRIST TYPE ROBES  WHO SAY ANAL SEX BETWEEN MEN VERY GOOD ( SO THAT ZIONIST JEWS WILL OPEN MORE BRANCHES FOR THEM AROUND THE WORLD AND GIVE THEM PUBLICITY IN ROTHSCHILDs MEDIA )  ,  WHO STAY IN 5 STAR HOTELS --

NOWADAYS MENTALLY SICK PEOPLE ARE CLAIMING TO HAVE RAISED THEIR KUNDALINI AND OBTAINED SAMADHI.     WHEN SUCH  MAD PEOPLE WITHOUT EGO ( BECAUSE THEY ARE MAD ) DIE , THEIR GREEDY AND EVIL FOLLOWERS CONVERT THEM INTO GODS  AND START CULTS , WITH POLITICAL AND COLLEGIUM  JUDICIARY  SUPPORT.   BIG FOREIGN  MONEY IS INVOLVED . 

In Samadhi, there is neither Dhyana nor Dhyata (neither meditation nor meditator). The meditator and meditated, the thinker and the thought, the worshipper and the worshipped become one or identical.. Samādhi is the highest state of consciousness that a human can reach in life. It is the goal of our spiritual journey on earth. Samadhi is the blissful return to our Divine origin. When the thousand-petalled Lotus of the Sahasrara Chakra opens and the Jivatma dissolves within it, the goal of its long, experience-rich journey is reached, and its lifelong thirst for the “nectar of immortality” (Amrita) is quenched. There is no longer any individuality. Consciousness and self-awareness continue to exist, but not in the previous duality of “that is mine” and “that is yours”. The person lives on, but from now on the inner Self remains with the Supreme Self. This means the end of all problems and pain, the end of suffering, of rebirth and death. The liberated one lives on the earth in eternal happiness and joy, and when the body is renounced the consciousness dissolves completely in the Divine Self. As in sleep, physical sensations such as heat, cold, hunger, thirst, etc., are strongly diminished in Samadhi. The state of Samadhi, however, is in no way detrimental to the body. The atma is at all times connected to the body, and is a witness to everything that occurs. Therefore, at any time one can return to “normal consciousness” just as one instantly awakens from a dream if touched or spoken to. Samadhi is the Supreme Consciousness in which knower, knowledge and object of knowledge unite. A peaceful nature, all-understanding goodness, purity, splendour and a quiet dignity radiate from a God-Realised soul. When all the “seeds” of the Vasanas (desires, wishes) have been roasted and burnt in the “fire of Yoga” can they no longer sprout. Only then does the door to liberation open to the aspirant. Because from then on one’s actions produce no new Samskaras in one’s consciousness, and therefore no more effects for subsequent lives. With the dissolution of the ego – when the distinction of “my I” and “your I” no longer exist – the Sanchitkarma ((Karma from earlier lives) also dissolves. He is so much established in that state of spiritual consciousness or awareness that even while he is moving and acting, he still remains in that state of inner awareness. He has no use for Guinness book of world records , dye for hair /beard , or faalthu limelight on TV.  They no longer identify with body, mind, senses, emotions, qualities, worldly position or profession. Their inner bliss is unshakable. The last chains of Karma dissolve, and all associated attachments vanish. They discover the entire Universe within and also identify the Self with the Cosmos.  Nirvikalpa Samadhi means "free from all sorts of modifications and imaginations." The mind completely melts in BrahmAn. A sudden stroke of mystic illumination puts an end to all the empirical existence altogether and the very idea or remembrance of such a thing as this world or the narrow individuality of the spirit in this world absolutely leaves the Self.  When you enter into nirvikalpa samadhi, however, you not only feel bliss, but actually grow into that bliss.  You see the universe as a tiny dot inside your vast heart. When the yogi can: (1) sustain focus on the pratyaya for an extended period of time, and (2) minimize his or her self-consciousness during the practice, then dhyana transforms into samadhi. In this fashion then, the yogi becomes fused with the pratyaya. Patanjali compares this to placing a transparent jewel on a colored surface: the jewel takes on the color of the surface. Similarly, in samadhi, the consciousness of the yogi fuses with the object of thought, the pratyaya. The pratyaya is like the colored surface, and the yogi's consciousness is like the transparent jewel. Samadhi is a spiritual state of consciousness. When the object of meditation engulfs the meditator, appearing as the subject, self-awareness is lost. When, in meditation, the true nature of the object shines forth, not distorted by the mind of the perceiver, that is absorption (samadhi).  In samadhi the mind becomes still. It is a state of being totally aware of the present moment

THIS POST IS NOW CONTINUED TO PART 62, BELOW--







CAPT AJIT VADAKAYIL
..






53 comments:

  1. Good afternoon dear sir,

    Please tell your opinions about mobile towers which established above home roofs in residential areas.

    Your follower
    Nishant

    ReplyDelete
  2. Respected Captain Vadakayil
    https://www.yahoo.com/news/document-israeli-mossad-trained-mandela-211040876.html?soc_src=social-sh&soc_trk=tw
    Did Mossad train Nelson Mandela at any point of time?
    Regards

    ReplyDelete
    Replies
    1. mandela was rothschild's agent !

      he was released from jail and made president designate only after he declared the RIGHT OF ISRAEL TO EXIST

      THE JEWS IN ISRAEL DO NOT BELONG THERE-- THEY DONT LOOK THE SAME-THEY HAVE DIFFERENT DNA

      Delete
  3. THE DESH BHAKTS OF INDIA WANT ALL GANDHI MEMORIALS AND STREETS TO BE RENAMED AFTER ABDUL KALAM

    WE THE PEOPLE OF INDIA WILL NOT ALLOW A SINGLE MEMORIAL IN THE NAME OF THE ITALIAN WAITRESS , HER MULATTO CHILDREN AND THAT SARPANCH TYPE WOMAN PRATIBHA PATIL..

    THE MEMORIALS OF RAJIV /INDIRA/ NEHRU MUST REMAIN.

    http://ajitvadakayil.blogspot.in/2012/07/indias-worst-president-ever-so-what-she.html

    ReplyDelete
  4. Ajit Vadakayil, in Yuktibhasa or our mathematical texts, have we used Projection mapping using matrix, etc As i know Matrix did come from our ancient mathematical work

    ReplyDelete
  5. http://timesofindia.indiatimes.com/india/Send-Bhagwant-Mann-to-drug-and-alcohol-rehab-MPs-write-to-Lok-Sabha-Speaker/articleshow/53501772.cms

    everybody knows about the DRUG and alcohol addiction problems of this mann character.

    everybody knows how kachchrawaal got 4 lok sabha seats from punjab

    khujliwaal himself needed a PSYCHOLOGICAL test become he could take over the post of CM of delhi.

    ReplyDelete
    Replies
    1. Hi Captain

      Both have increasing hold for upcoming elections in Punjab ... don't know from where they are getting funds ...and people's of Punjab are frustrated from ruling party and Both BJP and Congress losing ground day by day.

      This party will definitely get benefit from the weakness of BJP and Congress.

      Delete
  6. http://timesofindia.indiatimes.com/india/Smriti-Irani-goes-to-bat-again-this-time-for-handloom-saris/articleshow/53493656.cms

    TODAYs WANNABE GORAGAAND INDIAN WOMEN ARE CALLED CHUTNEY MARYS . .

    THEIR MALE EQUIVALENT IS CALLED PICKLE JOHN --THE QUINTESSENTIAL BROWN SAHEB . .

    KITHNA BHI KOSHISH KAREGA, PICKLE / CHUTNEY KA BHAANSS ZAROOR AYENGA BHAIYYA . .

    THESE SELF LOATHING CREATURES ARE A KALANK TO INDIAN CULTURE. .

    MODERN INDIAN DANCE FOR WHICH WE HAVE CHUTNEY MARY/ PICKLE JOHN JUDGES ARE ALL ABOUT SHOWING ASS, PELVIC THRUSTS, ACROBATICS, TRAPEZE, GYMNASTICS, ROTATING ON HEAD, SOMERSAULTS , GRACELESS VULGAR MOVEMENTS --

    AARRRGGHHH PPTTHHEEOOYYYYYYY

    ReplyDelete
  7. ### COMPLETE COLLECTION OF RAJIV MALHOTRA'S BOOKS ###

    https://www.scribd.com/collections/17076226/Rajiv-Malhotra-Books

    Ajit ji , Knowledge should be free to all which is the motto of our rishis ,these books will increase the awareness in common people and help them become a responsible and usable citizens hence i want everyone to get access to the books , please publish the comment

    ReplyDelete
    Replies
    1. Hi nami , I've re-checked the link its working fine , if its not working for you login in to Scribd and try again

      Delete
  8. Namaste Ajitji,
    Sir why is there difference in shravan month between S India & N India.
    Regards.

    ReplyDelete
    Replies
    1. NORTH INDIANS HAVE BEEN FOOLED BY JEW ROTHSCHILD

      THEY MARRY AT NIGHT--WHICH IS NOT ALLOWED IN SANATANA DHARMA

      Delete
  9. Not related to the topic..but I am 38 yr old woman vegetarian...suffering from severe hairball and dry scalp with dandruff forming clumps of dead skin.hairball is leading to severe depression.pls help.

    ReplyDelete
    Replies
    1. APPLY VIRGIN COCONUT OIL ON HEAD BEFORE BATH

      DO SURYA NAMASKAR

      DO HEAD STAND-- AT AGE OF 38 IT IS DIFFICULT

      LIE ON BED FACE DOWN AND ALLOW THE HEAD TO TOUCH THE FLOOR.

      Delete
    2. Dear Capt.,
      Please clear my doubts. Why should virgin coconut oil be applied and then immediately we should take bath? ..shouldnt the oil seep in to the skin and remain for some hours...if we bath we will be washing away the oil which should ideally be nourishing our body. What exactly is the logic of oil massage/application and immediate bath thereafter... and what is teycha kuli (oil bath )malayalis do? Can virgin coconut oil be applied AFTER a soap bath so that the skin can absorb more oil properly

      Delete
    3. YOU CAN DELAY THE BATH, IF YOU HAVE THE TIME

      Delete
  10. ADI SHANKARACHARYA ( 2000 BC ) GETS THE VADAKAYIL PRIZE. THIS PRIZE IS NOT WORTH A GREAT SOUL LIKE HIM-- STILL LET IT BE !

    HERE IS THE THE LIST OF MAHA MERUS WHO FOOLED THE WORLD , WHOM I HAVE TRASHED INTO THE GARBAGE BIN OF THE PLANET.

    GARBAGE BUCKET LIST:

    1) BERTRAND RUSSEL
    2) ROMILA THAPAR
    3) IRFAN HABIB
    4) NOAM CHOMSKY
    5) RAMCHANDRA GUHA
    6) SHELDON POLLOCK
    7) SIGMUND FREUD
    8) GEORG WILHELM HEGEL
    9) AMARTYA SEN
    10) WENDY DONIGER
    11) FREIDRICH WILHELM NIETZSCHE
    12) IMMANUEL KANT
    13 ) BARUCH SPINOZA
    14) ALBERT EINSTEIN
    15) ISAAC NEWTON
    16) GUGLEILMO MARCONI
    17) CHARLES DARWIN
    18) KARL MARX
    19) MAX WEBER
    20) THOMAS ALVA EDISON
    20) FIBONACCI

    NOTE: MENTAL MIDGETS LIKE ROMILA THAPAR , INFAN HABIB , RAMACHANDRA GUHA, SHELDON POLLOCK, WENDY DONIGER MUST BE THANKFUL THAT THEY ARE INCLUDED AMONG A LIST OF CEREBRAL GIANTS

    #########################

    HERE ARE PEOPLE WHO MADE A DENT IN THE UNIVERSE— THEY GET THE "VADAKAYIL PRIZE". THIS IS NOT A VESTED “NOBEL PRIZE “

    1) NIKOLA TESLA
    2) DIMITRI MENDELEYEEV
    3) IE IRODOV
    4) ARYABHATTA
    5) SRINIVASAN RAMANUJAN
    6) CHANAKYA
    7) ADI SHANKARACHARYA

    capt ajit vadakayil
    ..

    ReplyDelete
  11. http://timesofindia.indiatimes.com/india/Now-its-yoga-instead-of-routine-drills-for-BSF-jawans/articleshow/53510466.cms

    LEFT RIGHT LEFT RIGHT WAS REQUIRED WHEN SOLDIERS HAD TO MARCH HUNDREDS OF KILOMETERS..

    NOW WHAT IS REQUIRED IS SPRINTING , ROPE CLIMBING, AND YOGA...

    ReplyDelete
  12. http://timesofindia.indiatimes.com/world/middle-east/Turkeys-Erdogan-accuses-West-of-supporting-terror-coup-plotters/articleshow/53507499.cms

    sorry--

    WEST SAVED CRYPTO JEW ERDOGAN . .

    ReplyDelete
  13. http://www.femina.in/relationships/love-sex/a-beginners-guide-to-dirty-talking-14786.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA

    USED ON BOTH SIDES

    ReplyDelete
  14. http://timesofindia.indiatimes.com/life-style/relationships/love-sex/Revealed-How-to-keep-sexual-attraction-alive-in-a-relationship/articleshow/53499529.cms

    TOILET PAPER UNDERSTAND ONLY DIRTY LUST

    ReplyDelete
  15. Captain,
    Times Now and Arnab have systematically propagated for entry of chutney marys in shani shignapur,and is still doing.
    how to deal with him,he is showing him as patriot but a 100% anti-hindu inside.

    ReplyDelete
  16. the sabarimala crowd photo you posted has actors jayaram and vivek oberoi in it

    ReplyDelete
  17. Universities are fast losing their moral compass...
    http://www.thenewsminute.com/article/bengalurus-christ-university-has-stifled-those-who-stood-sexual-harassment-student-writes

    ReplyDelete
  18. PLEASE REQUEST ALL TO READ BETWEEN LINES OF THIS ARTICLEAND SHARE.
    http://www.hindupost.in/society-culture/kumbh-mela-risk/

    ReplyDelete
  19. http://www.reformation.org/1956-suez-canal-crisis.html

    ReplyDelete

  20. 1
    @endolith: If a salt crystal becomes wet there will be a solution of Cl- and Na+ ions in water at the surface. The evaporation of Cl- ions in a water droplet is possible, that the whole droplet is negatively charged still unlikely. Reductio ad absurdum: A pot of boiling salt water would create a gigantic amount of negative ions. – Alexander Mar 19 '12 at 16:57

    ReplyDelete
  21. Hi Ajith

    Looks like a concerted effort on to project India as sexually starved and country of rapists right from north to south, by corrupt media. Much of the news is not true and what is portrayed seem orchestrated! Is it another crooked brainwave as now the fad of intolerance is over and people are aware of corrupt media, so media tries the rape technique for bringing India down internationally?

    https://in.news.yahoo.com/sexual-abuse-plagues-female-workers-indias-sugarcane-fields-123131315.html

    ReplyDelete
    Replies
    1. hi gp,

      INDIA HAS THE LEAST PERCENTAGE OF RAPES ON THE PLANET

      capt ajit vadakayil
      ..

      Delete
  22. John
    July 31, 2016 at 2:51 PM
    Dear Captain Ajit,

    I have been following your blog very sincerely for some time. So much of the information is original and not to be found anywhere else on the internet. But I was surprised by your article on brahmacharya. India is the origin of the idea of celibacy and there still even today many in India who follow this noble way of life, though they will not found in the big cities( or aboard ships!) .

    Brahmacharya is semen retention, plain and simple – and this done through protecting the mind zealously and by being alone by oneself almost all the time. The eyes are protected – Visual Brahmacharya just as the mind. Then there will not even by nocturnal emissions.

    By saying that brahmacharins are homosexuals, you are doing a great dis-service to India and Indians . There many young people who follow your blog and this article will do them great harm. Also even to Westerners who look up to India for matters of the Spirit. It will also reduce the credibility of your other articles where you are undoubltedly right.

    I am also surprised that nobody has bothered to correct such a big faux pas on your part. Or is it that you do not publish comments which are critical unless you also post a rejoinder? If that is the case, this comment might also not see the light of day! Whether you publish this or not, please think about it – Is it possible for a person who is living a worldly life and who is not a celibate to really understand this way of life without living actually it? This is like a person who has never entered the water all his life, trying to explain butterfly stroke!. There is no question of doubt. Sir, you very very wrong regarding your views on Brahmacharya.

    Regards,
    John

    ReplyDelete
    Replies
    ################################################
    Capt. Ajit Vadakayil
    July 31, 2016 at 3:24 PM
    hi j,

    PEOPLE WITH COMMONSENSE WILL NEVER CONFUSE CAUSE AND EFFECT.

    EXAMPLE: A SHIP RAN AGROUND AND THE MAST FELL DOWN . ONLY A DRIPPING CHOOT WILL SAY THAT THE MAST FELL DOWN AND SO THE SHIP RAN AGROUND.

    IF BY WITHHOLDING SEMEN YOU CAN MOVE CLOSER TO LIBERATION --THIS IS THE BIGGEST CROCK OF SHIT ON THIS PLANET.

    ON THE OTHER HAND--

    BY SPIRITUAL PRACTICE AND YOGA IF YOU MORE CLOSER TO LIBERATION ,( AND IF MISS WORLD SITS ON YOUR LAP , IT IS THE SAME AS YOUR PET CAT SITTING ON YOUR LAP ) WELL THEN SEMEN RETENTION IS EMINENTLY POSSIBLE.

    THE BLOG SITE WILL NOT ALLOW HOMOSEXUALS AND TATTUS ( WHO CANT GET IT UP ) TO FOOL THE HINDUS ANY MORE, BY IMPLYING THAT THEY ARE LIBERATED.

    AMONG THE CURRENT FAKE GURUS , I KNOW WHO ARE ALL HOMOSEXUALS AND WHO ARE ALL TATTUS ( WHO CANT GET IT UP )-- BASTARDS WITH FEEBLE AURA RIDDEN WITH DARK HOLES . THEY WERE HAVING ANAL SEX / ORAL SEX EVEN IN SCHOOL.

    NONE OF OUR ANCIENT MAHARISHIS WERE UNMARRIED, UNLESS IT WAS BECAUSE THEY TOOK SOLEMN VOWS , AS A PERSONAL SACRIFICE TO BENEFIT THEIR BENEFACTORS.

    I AM THE FIRST TO WRITE AFTER ADI SHANKARACHARYA THAT HOMAMS AND YAJNAS CANNOT BE PERFORMED BY MEN WHO ARE UNMARRIED OR ARE WIDOWERS.

    I ASK THE POPE-- STOP THIS NONSENSE OF FORCING YOUR CATHOLIC CLERGY TO BE UNMARRIED WITHOUT FAMILY

    ADI SHANKARACHARYA DIED 100 YEARS BEFORE BUDDHA WAS BORN. BUDDHA WAS BORN IN 1900 BC ( NOT 1400 YEARS LATER AS RECORDED BY THE WHITE MAN ).

    capt ajit vadakayil
    ..

    Delete
    ####################################
    Bony
    August 4, 2016 at 8:05 AM

    Mr Ajit,

    First of all, I would like to say that this post is actually a message to you.It need not be published in your blog.And you need not reply.


    CONTINUED TO 2-

    ReplyDelete
    Replies
    1. CONTINUED FROM 1-

      Let me introduce myself. I am a spiritual seeker who has renounced the world. Yes, I am a brahmachariand a yogi. I am now roaming the hills and forests in search of a genuine adept of Yoga. Those Gurusyou see in public are either complete frauds or else of limited achievements. I have noted your unpleasant and illogical rant against John for stating stem truths.He probably did not reply as he felt that it was no use.The only reason I am writing this is because a man like you..a patriot and full of sincerity and love for our motherland needs to be told the following truths.I could have easily allowed you to continue to wallow in your ignorance but I felt that you deserve to get this knowledge.

      1) Brahmacharya is literally a way of life (acharya) which leads to Brahman. It is complete sexual purity as a result of which gross semen is never even formed in the body, let alone allowed to escape outside it. Brahmacharya is well truly alive in India today, but finding a genuine man who has achieved practical success is not at all easy.

      2) In 21st century India, there still exist great adepts who are not very easy to find.They are the true guardians of India who always watch from the background and step in only in very critical moments.

      To state one example - Buddhism had spread all over India and much of Asia.But the masters send out critical men (eg Shankaracharya) and made sure that Hinduism was not wiped out.Though they did not do the same for many other countries -china, japan etc.

      More examples - Islam has a tendency to wipe out the old beliefs (see Arabia).But in India only minimum damage was allowed (to allow for kaliyuga). Similarly in the Americas christianity completely wiped out the native religions, but in India even though the British managed to set up christianity, Hinduism still emerged out of the rubble. Also the rise of the BJP and Hindu revivalism in modern India is another effort by the great Masters who unobstrusively work in the background. They have stated that India will in this century become a major world power (as you also have said). So we have nothing to worry about- India is divinely protected..

      Yours sincerely
      Mag.

      Delete
      #########################################
      Capt. Ajit Vadakayil
      August 4, 2016 at 9:02 AM
      hi b,

      there are MORE women on the planet who masturbate to porn on internet than men.

      the internet has been a great eye opener.

      gay internet sites are surfed maximum in vatican city ( by percentage )--we are talking about PERCENTAGE not sheer numbers

      the idea of yoga / spirituality is to harness the mind

      when your harness the mind, you dont need to surf internet porn or visit whorehouses.

      LIKE GANDHI YOU DONT HAVE TO GIVE BULL TO THE WORLD ( USING ROTHSCHILDs MEDIA ) THAT YOU SLEPT WITH UNDER AGE GIRLS FOR YEARS UNDER THE SAME BLANKET AND GAVE / RECEIVED ENEMAS TO DO SELF EXPERIMENTS IN THE NAME OF BRAHMACHARYA.

      gandhi was addicted to KLISMAPHILIA --i can write a full post on this subject--but then i would puke.

      Klismaphilia is a immoral and debauched sexual gratification involving enemas.

      THIS IS THE WORST FOR OF SEXUAL DEPRAVATION ( FETISH ) AS IT INVOLVES TWO OTHER DEVILISH SEXUAL FETISHES NAMED UROPHILIA ( URINATING DURING ORGASM ) AND COPROPHILIA ( SHITTING DURING ORGASM ).

      the hollywood XXX sex movie was censored to keep out this highest human depravation--this was too much even for perverted creatures. if you see the uncensored version of DEVIL IS MISS JONES you will know what i mean

      gandhi went one step futher-- he has the sadistic bit of asking his wife kasturba to empty the chamber pot containing the excreted fluids .

      i respect jew rothschild for not giving gandhi the nobel peace prize-- see every body has something good in him.

      the pervert psychologist SIGMNUND FRUED explained why gandhi used his own underage niece to go upto the highest notch in sexual perversion.


      CONTINUED TO 3-

      Delete
    2. CONTINUED FROM 2-

      In The American Journal of Psychotherapy (Apr76, Vol. 30 Issue 2, p236, 20p) Freud’s interprets this extreme and immoral paraphilia, “In receiving the enema, the patient identifies with his mother, while the one administering the enema represents his father. The enema represents the act of copulation and the patient emerging from the experience, an "excrement infant".

      I WONT TALK FURTHER OF THIS DEVIL --JEW SIGMUND FREUD -- WHO COMMITTED SUICIDE.

      i gave a brief mention in the post below-- social responsibility prevents me from exposing more

      http://ajitvadakayil.blogspot.in/2015/08/homosexuality-pedophilia-deviant-porn.html

      there are enema spas in europe and scandinavia where attractive women ( these are not whores but school girls ) give enemas to ELITE men for sexual pleasure-- for very high remuneration . these school girls do ANALINGUS for money--some for gays

      Ashley Hames of SIN CITIES wrote about his experiences , when a young school girl drank red wine from "YOU KNOW WHERE "

      There are depraved gays who consume alcohol by the asshole ( enema )-- alcohol absorbs into the bloodstream faster than the digestive system. Many have died.

      Devil in Miss Jones (1973), written and directed by the same man who created Deep Throat (1972)-- the Jewish husband of Linda Lovelace .

      German XXX movie Water Power (1977), featured the Enema Bandit ( SCHPRITZ ) -- it became a kinky cult. Literally many school girls has their ass in a sling .

      YOU CANT TEACH CAPT AJIT VADAKAYIL ABOUT SEX.

      DONT EVEN TRY

      THERE IS A DIFFERENCE BETWEEN REDUCING SEXUAL THOUGHT BY GOING UP THE SPIRITUAL PATH -- AND WITHHOLDING SEMEN ( BULLSHIT ) WITH TATTUS/ GAYS GRABBING POWER

      I HAVE SEEN HUNDREDS IN LIFE WHO GET CONFUSED WITH CAUSE AND EFFECT.

      ADI SHANKARACHARYA ( 2000 BC ) HAPPENED BEFORE BUDDHA ( 1900 BC ) -- BUDDHA WAS NOT BORN JUST BEFORE ALEXANDER THE GREAT INVADED INDIA

      THERE ARE LYING WHITE MEN WHO WRITE PATANJALI COPIED HIS YOGA FROM BUDDHIST MONKS AND THAT PALI EXISTED BEFORE SANSKRIT -- BR AMBEDKAR WAS ONE OF THEM.

      LIES WONT WORK !

      allow capt ajit vadakayil to wallow in his ignorance--i crave your indulgence --

      THANK GOD FOR SUCH TENDER MERCIES !

      capt ajit vadakayil..

      Delete
    3. So, to summarize - if one follows TRUE brahmacharya then semen-control (sensory control) will automatically happen. The converse, i.e. if you control semen, then you are following true brahmacharya, is NOT true.

      Delete
    4. THIS IS WHAT SANATANA DHARMA SAYS

      THERE ARE IDIOTS WHO GO TO DELHI TO FILL UP A FORM , JUST BECAUSE THE FORMS SAYS FILL UP IN CAPITAL ( UPPER CASE )

      IF TRIPLE ENZYME SRI IS NOT CAREFUL THERE ARE PEOPLE ABOARD WHO DID HIS SUDRASHAN KRIYA HYPERVENTILATION AND FRIED THEIR BRAINS ( SHAKTI OIL TYPE CON ).

      HE MUST BE PREPARED TO SHELL OUT MORE MONEY IN LITIGATION THAN HE DID AT YAMUNA RIVER WITH HIS SOUR VINEGAR --NAY-- ENZYME.

      Delete
  23. Please tell us significance of early morning bath than late bath

    ReplyDelete
  24. DURING MY 30 YEARS OF COMMAND --

    ON EVERY SINGLE SHIP , IN SAFETY MEETINGS ( i hold it on the navigating bridge in the open ocean ) I TAKE THE SOUND MEGAPHONE --BASICALLY A CONE WITH A HOLE AND ASK -

    WHAT IS THE USE OF THIS?

    EVERY SINGLE SAILOR SAID - TO SHOUT OUR ALOUD , TO AMPLIFY THE VOICE AND DIRECT IT

    THIS IS BULLSHIT

    THE HOLE HAS TO BE APPLIED TO THE EAR TO CHANNEL IN ANY SOUND DURING FOG --SO THAT YOU KNOW WHAT IT IS COMING FROM

    WHEN TITANIC SANK IN FOG --THE STUPID BRITISH OFFICERS IN RESCUE BOATS WERE SCREAMING THEIR LUNGS OFF INTO THE MEGAPHONE "ANYBODY AROUND ?"

    AND POOR DROWNING PEOPLE STIFF WITH COLD WERE SHOUTING BACK-- "I AM HERE "

    THIS IS WHY I SAY " SOME PEOPLE CONFUSE THE MOUTH WITH ASSHOLE"

    THOUSANDS OF SAILORS DROWNED WHEN THE SHIPS SANK-- THE LIFE RAFTS DID NOT RELEASE

    IT TOOK A CAPT AJIT VADAKAYIL TO SET IT RIGHT -- IT TOOK A LOT OF FIGHTING AND KICKING COLLECTIVE BALLS

    IT TOOK ME 26 YEARS !

    SENDING EMAILS AND LETTERS TO VARIOUS AUTHORITIES , US COAST GUARD, CLASSIFICATION SOCIETIES, VETTING INSPECTORS, PORT STATE CONTROL , COMPANY BOSSES ETC

    EVEN MY OWN SAILORS COULD NOT UNDERSTAND --THEY COULD ONLY WHEN I EXPLAINED WITH FUCK / SHIT / FART ETC

    THIS IS HOW STUPID SAILORS ARE

    I PREVENTED MY ELDER SON FROM JOINING THE SEA

    HE WANTED TO BE CAPTAIN, LIKE HIS FATHER

    I SAID "NOTHING DOING ! YOU WILL BE BETWEEN DRIPPING CUNTS "

    http://ajitvadakayil.blogspot.in/2011/01/naive-sailor-sinking-ships-capt-ajit.html

    NOW YOU WILL GET THE DRIFT , WHY CAPT AJIT VADAKAYIL WAS A LIVING LEGEND AT SEA

    WHAT ABOUT LIFE BOATS ?

    IT TOOK ME 28 YEARS OF KICKING COLLECTIVE BALLS AND TWATS

    http://ajitvadakayil.blogspot.in/2011/01/single-hook-for-enclosed-lifeboats-capt.html

    http://ajitvadakayil.blogspot.in/2011/07/enclosed-lifeboat-accidents-and-imo.html

    WE HAD IMO TO SAVE THE LIVES OF SAILORS --THEY WERE THE BIGGEST CUNTS

    https://en.wikipedia.org/wiki/International_Maritime_Organization

    capt ajit vadakayil
    ..

    ReplyDelete
  25. Hi Ajit,

    Is it necessary to do Pranayama in Floor without any Matress or any bad conductor ? I am doing Pranayama for last 10 years either sitting on matress or in my bed.Your opinion requested

    With best wishes,

    Sushanta Das

    ReplyDelete
    Replies
    1. PRANAYAMA AND MEDITATION OF INSULATOR MAT

      YOGA ASANA ON CONDUCTING GROUND

      Delete
    2. Thanks Ajit,for your reply.

      Sushanta Das

      Delete
  26. Sir, please please i request u to please see this .

    This Guy has exposed all R ..... he himself must be an awakened R....

    https://www.youtube.com/watch?v=KrUXPn7HCjM

    ReplyDelete
  27. Capt what's your view on Jcvd van bam!? I think he is real man and loved his slow paced movies....more loved him for his anti R stand

    ReplyDelete
  28. Hello sir tell me about dattatreya is really exist

    ReplyDelete
  29. Captain This Is Really Important...
    I Want to know do you type all these in a mobile or pc. And also I want to know how can you type so much in such a short period of time. And should i read vivekananda commentary on raja yoga... or you hve done a better job than him ?? So what should i do ?... i read vivekananda earlier i liked his work but you said that not even a single word by him is usefull so should i completely drop reading his books??? so where should i read from..? and captain i also want to know what ever you write are these words your own experience and your own understanding .... is there any guru in india that can match you in rigor and explanation...? waiting for ur reply... thank you.. ALSO WHAT DO you have to say abouy ramana maharishi and osho?

    ReplyDelete
    Replies
    1. hi s,

      if you copy and paste all WORDS in this blogsite on a microsoft office WORD document, you can see the total number of words typed at the bottom left hand corner

      within a few years ( i started blogging a few year ago when i was still at sea , without access to the internet) , this is the largest number of words EVER typed by a mortal--past and present .

      i type with two fingers--i dont correct type mistakes , as i dont need to impress anybody.

      i have left vivekananda alone-- all i will say is , an self proclaimed yogi like him will not suffer from so many serious diseases . and vivekananda has LIED -- kottakkal arya vaidya sala recommended that he sit on a salt water spraying rock a kanyakumari ( in the ocean ) to recover from severe lung inflammation , as a part of ayurvedic treatment.

      Vivekananda LIED that he was meditating for world peace --with rothschild media giving him faalthu coverage .

      I would never do that .

      HERE IS THE MISSION OF MY BLOGSITE-

      This blogsite will transform your mind . You yourself, are the teacher, the pupil, the messiah, the seeker, the traveller and the destination . It is no measure of health to be well adjusted to this profoundly sick society . I am from INDIA, the mother of all civilizations . I will be re-writing world history , and this will surely not gratify the evil hijackers of human history . Awaken your inner voice . Experience the joy of your own being . Your own conscience is the best interpreter . In a time of universal deceit, telling the truth is a revolutionary act . The naked truth can never be hate speech or defamation. This blogsite does not sacrifice truth on the altar of political correctness . You shall know the truth and the truth shall set you free .

      I AM NOT A GURU- I AM FAR FAR SMARTER THAN VIVEKANANDA OR OSHO OR RAMANA MAHARISHI OR WHOEVER, AS I HAVE A TECHNICAL BRAIN

      I AM A BLOGGER WHO HAS SEEN THIS PLANET -- UNLIKE THE FROG IN THE WELL GURUS

      I HAVE NOT EVEN STARTED SERIOUS BLOGGING

      capt ajit vadakayil
      ..

      Delete
  30. STOP PRESS :

    kancha ilaih SQUEAK nay shephard came on TV couple of years ago.

    he was cracking up from within-- his voice quivered with sheer grief when he cried--THESE HINDU GODS ARE SO VIOLENT, THEY ARE ALL THE TIME KILLING PEOPLE

    to this SQUEAK i must say " hindus gods are all cosmic allegories except vishnu avatars "

    stop moaning that Brahmins did NOT allow shudras to learn vedas – this would be as irresponsible as a brain surgeon allowing his nurse to do brain surgery on a holiday .. vedas went on the oral route for 300 centuries, without losing a syllable , before they were penned down 70 centuries ago ..

    CONDENSATION DOES NOT KILL EVAPORATION--THIS IS A CONCEPT MEANT FOR THE WISE--NOT IDIOTS.

    http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html
    devdutt pattanaik who does NOT understand sanatana dharama comes on TV serials aand denigrated hindusim.

    he thinks that hindu gods are mortals , and their vahanas ( vimanas ) animals and birds.

    see the way amish tripati converted shiva to be a tribal sex started mortal and the white man loved him for it.

    devdutt pattanaik's attitude towards hinduism can be gauged from the post below--

    read the part n blue italics- where shiva is hiding from nandi bull who is waiting in ambush to rape shiva anally . . . reciprocation if you please . .

    http://ajitvadakayil.blogspot.in/2014/01/nandi-bull-vahana-and-gatekeeper-of.html

    if he did the same in saudi arabia to islam he would have been beheaded on the streets within an hour.

    this blogsite asks TIMES OF INDIA e-newspaper to stop denigrating Hinduism daily vide its SPIRITUALITY COLUMN.

    devdutt pattanaik must know there is no heaven and hell in Hinduism.

    somebody asked me about old people-- even from kerala-- going to KASHI GHATS to die.

    well in olden days due to the saraswati river underground component, there was a MOBIUS COIL water flow at the ghats . people whose souls departs from this massive SCALAR FIELD gets a boost of ONE astral layer

    same with kailash mountain-- pandavas walked to mount kailash before they died.

    pyramid shaped mount kailash has an ORGONE FIELD due to the golden mean of 1.618 .

    http://ajitvadakayil.blogspot.in/2010/12/secrets-of-egyptian-pyramids-revealed.html

    THIS BLOGSITE WARNS JNU COMMIE PROFESSORS, NOT TO COOK UP FALSE STORIES ABOUT SANATANA DHARMA . .

    WE DONT WANT COMMIES TO SAVE INDIA..

    capt ajit vadakayil
    ..

    ReplyDelete
  31. WARNING:

    THIS BLOGSITE WARNS ARNAB GOSWAMI, THE TV ANCHOR OF TIMESNOW TV - -

    YOU SHALL STOP YOUR SLIMY ANTI-WATAN AND ANTI-HINDU PROPAGANDA IMMEDIATELY ..

    YESTERDAY THIS MORON WAS EQUATING "MENSTRUATING WOMEN ENTERING SABARIMALA TEMPLE" WITH "SATI "

    SABARIMALA IS THE WORLD LARGEST PILGRIMAGE, AND THE ONLY REAL PILGRIMAGE WHICH DOES GOOD TO THE PILGRIM . . BECAUSE OF THE AUSTERE VRAT FOR 41 DAYS .

    http://ajitvadakayil.blogspot.in/2013/01/sabarimala-makaravilakku-three-light.html

    WE INDIANS NEVER HEARD OF THE TERM "SATI" TILL THE WHITE INVADER CAME TO INDIA . .

    NO PURANA STORY EVER TALKS ABOUT A WIDOW JUMPING INTO HER HUSBAND PYRE.

    IN THE CASE OF SHIVA WIFE SATI--SHE SELF IMMOLATED.

    http://ajitvadakayil.blogspot.in/2013/02/vedic-hindu-fire-temple-of-baku.html

    EXCEPT VISHNU AVATARS ( RAM , KRISHNA ETC ) , ALL HINDU GODS AND THEIR WIVES ARE AMAZING COSMIC ALLEGORIES.

    HINDU WOMEN JUMPING INTO THE FORE STARTED ONLY WHEN ISLAMIC INVADER SOLDIERS STARTED RAPING DEAD WOMENs BODIES.

    SO THE WOMEN ( WHOSE HUSBANDS DIES IN BATTLE ) JUMPED INTO THE FIRE ENMASSE --AS PRACTISE CALLED JAUHAR.

    THIS IS EVEN TODAY BEING DONE BY "LIVE" SLAVE YAZIDI WOMEN , TO FUSE THEIR GENITALS AND DISFIGURE THEIR FACES.

    http://www.independent.co.uk/news/world/middle-east/isis-soldiers-rape-yazidi-girl-sets-herself-on-fire-burns-alive-iraq-refugee-camp-a7208656.html

    YAZIDIS ARE ANCIENT HINDUS

    THIS BLOGSITE WAS THE FIRST TO REVEAL IT AND IMMEDIATELY THE NO 1 OPPORTUNIST SRI SRI RAVISHANKAR RAN THERE TO GRAB FAYADA. LIKE HOW HE WENT TO MEET BURHAN WANIs FATHER TO GRAB THE LIMELIGHT AND FAAYADA.

    HOMOSEXUALITY AND HYPERVENTILATION FAKE YOGA PUSHING SRI SRI RAVISHANKAR DOES NOT REPRESENT INDIA OR HINDUS . THIS BLOGSITE SAYS SO.

    ARNAB GOSWAMI I KNOW YOU WILL READ THIS-- I HAVE MULTIPLE SOURCES AMONG TIMESNOW TV STAFF - -

    YOU SHALL STOP GIVING A PLATFORM TO DESH DROHI PAKISTANIS ( THE WAY YOUR KOSHER BOSSES WANT ) , SEPARATISTS, NAXALITES AND RABID ANTI-HINDU PERCEPTION MOLDERS

    punch into WORST JOURNALIST mr arnab goswami-- what do you see?

    my post about anti-hindu anti-watan NON-FADING VIOLET is no 1 among 35 million posts .

    i will give YOU the most dubious honor ever -- the worst legacy ever for a journalist --just ignore this warning and you shall see ---.

    ENOUGH IS ENOUGH - FISH MARKET JOURNALISM !!

    AAARGGHHH PPTTHHEEEOOOYYYYYYYY !

    capt ajit vadakayil
    ..

    ReplyDelete
  32. Maxmad
    September 2, 2016 at 6:02 PM

    Captain,before mongols invaded who was the ruler in Tibet ?
    Delete

    ###########################

    Capt. Ajit Vadakayil
    September 2, 2016 at 6:34 PM

    TIBET WAS PART OF INDIA AS LATE AS THE MAHABHARATA WAR IN 4000 BC , WHEN TIBETANS SIDED WITH KAURAVAS.

    INDIA RULED AS FAR NORTH AS URALS IN 7000 BC

    http://ajitvadakayil.blogspot.in/2011/12/stonehenge-of-arkaim-russia-capt-ajit.html

    JEW ROTHSCHILDs HISTORIANS CREATED A FAKE KING BHARAT, USING HIS FAKE AND BACKDATED DASAS.

    IT IS FUCKIN' LIE THAT KING BHARAT WAS SON OF THE FAKE AND BACK DATED SHAKUNTALA

    WE IN INDIA NEVER HEARD OF SHAKUNTALA TILL THE WHITE INVADER CAME TO INDIA.
    KALIDASA LIKE EVERY OTHER DASA NEVER EXISTED .

    http://ajitvadakayil.blogspot.in/2013/06/kalidasa-did-not-exist-jainism-is.html

    THE REAL EMPEROR BHARATA WAS THE SON OF EMPEROR RISHABA -- HE RULED TIBET .

    SVAYAMBHUVA MANU ( 8275 BC ) — PRIYA VARTA ( 8255 BC )- AGNIDHARA – NABHI RAJA -- RISHABHA (8190 BC ) – BHARATA ( 8165 BC ) .

    Emperor Rishabha ( Adinath ) , the father of Chakravatri Bharata is the founder of Jainism in 8190 BC, and is the first Thirthankara.

    IF CHINA ACTS TOO FUNNY , WE WILL SNATCH BACK TIBET .

    capt ajit vadakayil
    ..

    ReplyDelete
  33. http://insideepaclimate.com/daily-news/white-house-adds-methane-nitrous-oxides-social-cost-carbon-tool

    THIS BLOGSITE IS THE ONLY SITE WHICH PUSHED FOR THIS

    AND HENCE WILL TAKE CREDIT 100%

    HULLO PMO--

    IS THIS FICTION ?

    OR IS IT SOME DREAM LIKE " MUNGERILAL KE RANGEEN SAPNE " ?

    WHEN I WROTE THIS POST BELOW PMO CALLED IT FICTION .

    http://ajitvadakayil.blogspot.in/2016/04/most-potent-greenhouse-gases-nitrous.html

    NOW THAT GORA GAAANDS HAS TOLD IT-- PMO WILL AGREE

    ANGREZ KA SLAVES , STILL RUNNING PMO !

    capt ajit vadakayil
    ..

    ReplyDelete
  34. WE ASK THE INDIAN GOVT

    SHUT DOWN THE SOCIAL SCIENCES DEPTS IN JNU, DU, JU AND TISS

    THESE INSTITUTIONS SPAWN DESH DROHI COMMIES

    MOST OF THE PRODUCTS OF THESE STRAINS FINALLY LAND UP AS POLITICAL GOONDAS AND EVEN AUTO RIKSHAW DRIVERS

    WITH AFRICAN STUDIES UNDER HIS BELT --WHAT IS 30 YEAR OLD KANHAIYA KUMARS FUTURE --IF HE IS NOT TAKEN INTO SITARM YECHURYs FOLD ?

    MEANWHILE MAKE CLASS ATTENDANCE COMPULSORY-- BEWARE JEW NOAM CHOMSKY MIGHT GET ANGRY

    AND THEN APCO BRANDED MODI WILL LOSE HIS NOBEL PRIZE

    ReplyDelete
  35. LIES .. .LIES . . . .LIES . . .

    SRI SRI RAVISHANKAR HAS NOTHING TO DO WITH THE COLOMBIAN PEACE TREATY OR THE COLOMBIAN PRESIDENT GETTING NOBEL PRIZE . . .. . . .

    NEXT TIME SRI SRI RAVISHANKAR GOES TO SOUTH AMERICA HE WILL BE THROWN INTO JAIL FOR MANSLAUGHTER CAUSED BY HIS SUDARSHAN KRIYA SO HUM , AS PER MY SOUTH AMERICAN OFFICERS . .........

    VEDIC YOGA ALLOWS ONLY DEEP DIAPHRAGMATIC BREATHING . . . . . NEVER EVER HYPERVENTILATION…..

    When we do deep diaphragmatic breathing, our stress levels will decrease because it allows more oxygen to flow through the body. ..………

    Hyperventilation leads to an excessive elimination of carbon dioxide (CO2) whereas no significant additional amounts of oxygen can be stocked in the body…..

    The blood also becomes abnormally alkaline as a result of the excessive elimination of carbon dioxide; this subsequent rise in blood pH is termed alkalosis. Alkalosis interferes with normal oxygen utilization by the brain………

    In the body alkalosis generally induces vasodilatation (widening of the blood vessels) but in the brain alone it causes vasoconstriction (narrowing of the blood vessels)……

    Because the brain cannot store reserves of oxygen and, unlike other organs, has an exceedingly low tolerance of oxygen deprivation, it is highly vulnerable if vasoconstriction is not reversed……..

    Hypocapnia reduces the oxygen levels available to the brain due to the elevated affinity of oxygen to hemoglobin (Bohr effect) hence highly increasing the chances of blackout…..

    Hypocapnia is a state of reduced carbon dioxide in the blood. ……

    Hypocapnia usually results from deep or rapid breathing, known as hyperventilation like SUDARSHAN KRIYA , SO HUM ……Hyperventilation, or over-breathing, does not add oxygen to arterial blood…….

    Hyperventilation does not only reduce the total cerebral blood flow, but also changes the distribution of blood flow within the brain. ….Blood flow to the frontal, occipital, and parieto-occipital cortex, as well as the hippocampus is reduced relative to other areas of the brain within seconds to minutes of commencing hyperventilation…..

    Sri Sri Ravishankar does NOT have a technical brain . ….

    He has PATENTED this Sudharshan Kriya ( SO HUM hyperventilation ) by trying to rehash Yogic pranayama exercises like Bhastrika and Kapalabhati…..

    YOGA HAS SHUNNED HYPERVENTILATION , AND HAS USED BHASTRIKA PRANAYAMA ONLY TO SHIFT THE DOMINANT NOSTRIL ( IDA / PINGALA ) FOR A FEW SECONDS…….When alveolar ventilation is excessive, more carbon dioxide will be removed from the blood stream than the body can produce.

    This causes the concentration of carbon dioxide in the blood stream to fall and produces a state known as hypocapnia. ……

    Hallucinating effects have been used by FAKE gurus to make an as$ out of devotees…….. . .. .

    go0gle the blog post below---- ...............

    Hyperventilation followed by Valsalva maneuver causes irreversible brain damage or sudden death Vadakayil.................

    capt ajit vadakayil ..

    ReplyDelete