Wednesday, August 17, 2016









atha yoganushasanam
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tatah pratyakchetanadhigamopyantarayabhavashch
tatpratishedhartham ekatattvabhyasah
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih


tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
sthirasukham aasanam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah


deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti


janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah
purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti

4.24- - tadasankhyeyavasanachitram api pararthan sanhatyakaritvat

Though the framework of consciousness is interwoven with innumerable desires and subconscious impressions, it exists for the seer on account of its proximity to the seer as well as to the objective world.

Though consciousness has been fogged with impressions (samskaras) throughout eternity, its aim is not only to satisfy the desires of the senses (bhoga), but also to further the emancipation (apavarga) of the soul. Consciousness is tied by a hidden force both to the seer and to nature. It is well equipped to reach the seer, though it has no ambition of its own except to serve its Lord. Consciousness has innumerable inclinations and impressions derived from memory, among which longing for pleasures and freedom from pleasures stand out. They are desired impressions. From this, it becomes clear that consciousness, being close to nature and spirit, feels that it does not exist for its own sake but for the sake of purusa and prakrti.. Once consciousness is cultured through yogic discipline, it becomes matured and illumined. It realises that the seer is not interested in objects of pleasure and opts to serve with disengagement. Now that it comprehends its inner value, it realises the triviality of nature's pleasures and turns towards the path of Self-Realisation. Thus transformed, it begins its journey towards emancipation. If one's karmas are good, they awaken curiosity and guide it towards the path of kaivalya; they reward one's effort with the vision of the soul. Yogic practices speed up this process, beginning with the conquering of the body and ending in the vision of the soul.  This is salvation.  For most modern scientists (who have NO access to the wisdom of the Vedas ) mind appears to be the master, which receives numerous inputs through senses, synthesizes them and understands them. But, mind is not the master. It is just an efficient manager. It is always working for the Purusha, the pure consciousness. The master never appears in the forefront. But, the power of illumination belongs to the Master. The mind receives only a reflection of this power, to receive the numerous impressions of the world outside. One must understand the process very clearly and keep the mind as an efficient manager working for the self, which is the Purusha, the pure consciousness. The Purusha may be a mere witness, the ultimate seer. He may have the capability to illumine himself and illumine the mind, and through the mind, the external world. But, Purusha has to operate only through the mind, which has no self illumining capability, for which it depends on the Purusha. The bridge between the Purusha and the world is the mind. That mind field, though filled with countless impressions, exists for the benefit of another witnessing consciousness, as the mind field is operating only in combination with those impressions. However subtle we go in our exploration of the depths of the mind, that mind itself gets its life force from pure consciousness, like the electricity and the computer.   The computer cant perform without electricity. This pure consciousness is the Reality that we want to experience, unalloyed even by the subtlest aspect of mental process. While the computer operates for the external user, it is the other way around with consciousness. The mind field operates for the benefit of the consciousness. Though having countless desires, the mind-stuff exists for the sake of another [the Purusha] because it an act only in association with it. Though the fabric of consciousness is interwoven with innumerable desires and subconscious impressions, it exists for the seer on account of its proximity to the seer as well as to the objective world.  This is because the mind cannot function without the power of the Perceiver. The mind is a compound of various things, and therefore it cannot work for itself.  The proximity (samhatya) of the spirit is itself, the cause of the innumerable moods and urges.

4.25- - visheshadarshin aatmabhavabhavanavinivrittih

For one who realises the distinction between citta and atma, the sense of separation between the two disappears.

When the difference between consciousness (citta) and the projector of the consciousness (citi) is recognised, the search for Self-Realisation ends.  From iv.15 to iv.25, Patanjali takes the sadhaka progressively to the realisation that consciousness is not the all-knower, but simply an instrument of the soul.  For one who is not sure of the difference between consciousness and soul (citta and citi), an analogy is given; the blades of grass which shoot up during the rainy season prove the existence of the hidden seeds.  In this sutra Patanjali explains that the seed of the soul (atma bija) is sown at the right time for the knowledge of the soul (atma jnana) to be securely established. As one mistakes a rope for a snake at first glance, but realises upon examination that it is a rope, consciousness at this stage realises that it is not all-knowing, but an instrument of the soul. Avidya is vanquished and the practitioner thoroughly understands objective as well as subjective knowledge, without colourisation. Here all moods and modes cease to flow, and consciousness is elevated to the optimum degree to behold the inebriated state of the seer. The yogi is no longer drawn towards the temptations of the world. His search for the self ends. He becomes a master of yoga and a master of himself. He is yogesvara. This is the substance (svarupa) of yoga and a distinct attribute of the seer (visesa darsinah). For one who has experienced this distinction between seer and this subtlest mind, the false identities and even the curiosity about the nature of one's own self come to an end. After the yogi has explored the many currents and cross currents of the gross and subtle mind, there comes the realization of the separateness from all of these levels and pure consciousness. It is then, that all of these questions cease. It is not a case that they are analytically answered in logical words. Rather, the questions are resolved; they simply evaporate in understanding. Patanjali is now explaining the nature of that yogi who has realized the distinction between the seer, the seen and the mind very clearly. In other words, he is now the viveki, the one proficient in discriminating faculty; the one who can perceive the truth and differentiate it from the one which is not – easily. At this stage, the mind also is the purest possible reflector of external reality, without any coloring either on itself  or on the scenery.  The seer, the Purusha, the pure consciousness knows this. He has experienced the external reality in its purest form, since no coloring affects it now. There are now no false identities.  There is not even any further curiosity about the nature of one's own self. There is complete cessation of all doubt between the seer, the seen and the nature of mind. There is a complete cessation of any desire, including the desire to reside in the Purusha. The pure mind has come close to the Purusha and is accepting his Mastery. To one who sees the distinction between the mind and the Atman, thoughts of mind as the Atman cease forever. For one who realizes the distinction between citta and atma, the sense of separation between the two disappears. The man of discrimination ceases to regard the mind as the Atman. For one who has experienced this distinction between seer and this subtlest mind, the false identities and even the curiosity about the nature of one's own self come to an end.

4.26- - tada vivekanimnan kaivalyapragbharan chittam

Then consciousness is drawn strongly towards the seer or the soul due to the influence  of the exalted intelligence.

When the exalted intelligence is ablaze, consciousness is illumined; it becomes free and tinged with the divine (citta suddhi). Due to this divine light, citta, with its exalted intelligence, is attracted as if by a magnet towards its source - the indivisible seer who is alone, free and full. Before reaching the state of exalted intelligence, consciousness is attracted more towards the pleasures of the world. When intelligence is free from doubts and prejudices, it gravitates towards the absolute seer. As a farmer builds dykes between his fields to regulate the flow of water, similarly, exalted intelligence builds a dyke for the consciousness, so that it does not move again towards the world, but turns and flows towards union with the divine seer. This is kaivalya, an existence filled with freedom and beatitude. Such a yogi becomes a king amongst men. Viveka means clear discrimination between Truth and what is not truth. Truth liberates from ignorance, while what is not truth binds the sadhaka to Ignorance. The mind-field is always looking outward through the senses and its perception is always coloured. But, once the coloring is removed, the mind-field, the Chitta also becomes a clear, pure receiver of external wisdom because of the illuminating power that it has received from the Purusha.  Now, mind is inclined towards clear viveka or discrimination faculty in its power of perception and therefore, the ignorance binding it, comes down and down and tends to remove the veil of ignorance from the Purusha. Purusha is now shining clearly. Mind also therefore gravitates towards total liberation. What is the liberation? It is nothing but the dropping of all barriers to wisdom, the barriers to truth that had arisen in mind due to the covering of Ignorance. What is the ignorance of the mind-field? It is its identification with the body-mind complex. Once the self realizes that it is not the body-mind complex, the barriers covering the mind-field drop away easily. The mind-field should detach from the drisya and become and efficient aid of the real Master, the Prabhu, the Purusha, the self, the consciousness. Now, all barriers drop off. Discrimination, viveka comes home automatically. Renunciation, vairagya and liberation happen effortlessly, effectively and automatically. Then the mind is inclined towards the highest discrimination, and gravitates towards absolute liberation between seer and seen. When even the subtlest questions of life subside, there is only one direction left to go, and that is towards the realization of the absolute reality that is beyond. This is not a case of a lethargic mind having no question about the meaning of life; such a mind has not even entered the path of Self-realization. Rather, it comes from having questioned, explored, searched, and longed, through the gross, subtle, and causal levels, until finally, the point of the final discrimination stands in front of the seeker. When the mind is bent on the practice of discrimination, it moves toward liberation. And their clarity takes them to their only concern; to reach and remain in a state of freedom.  The yogi has to achieve this.  It does not come by wishful thinking.  Only through higher yoga can this be achieved consistently. Practice of Yoga leads to discriminating power, to clearness of vision. The veil drops from the eyes, and we see things as they are.  When discrimination comes by long practice fear ceases, and the mind attains isolation.

4.27- - tachchhidreshu pratyayantarani sanskarebhyah

Notwithstanding this progress, if one is careless during the interval, a fissure arises due to past hidden impressions, creating division between the consciousness and the seer.

The force of past impressions may create loopholes in the form of intellectual pride or other varying moods or modes of thought, which breach the consciousness and agitate the harmony and serenity of oneness with the pure Self (atmabhava). This sutra shows a way to fight old impressions that may influence the consciousness and crack it. Patanjali cautions that even for the supreme intelligence, the subconscious samskaras may surface in this intermediate stage and sway the consciousness. Patanjali advises yogis who wish to be released from worldly life to be incessantly vigilant in order to overcome these old habits, lest their consciousness wavers between the desire for perfection and actual perfection. The uninterrupted practice of yoga unconditionally crushes these fissures in consciousness, and eliminates doubts and prejudices, so that pure wisdom may shine. In the Bhagavad Gita 11.59, Lord Krishna says that inbuilt desire persists as a fissure even in the most austere renunciate. Only the vision of the Supreme resolves these latent faults forever. From that moment no worldly desire or temptation can endanger the composure and virtue of the yogi .Patanjali says, even at this point, there will be some very deep impressions, very deeply ingrained Samskaras, which rise again and again to pull down the viveka and put barriers in its path. This happens many times. This is because, some of these deepest, ingrained samskaras  take time and effort to be totally rooted out. The same methods already gone through for removal of samskaras must be continued to be adopted  till the last remnants are rooted out. For this, retaining a high level of awareness of them is however essential. When there are breaks or breaches in that high discrimination, other impressions arise from the deep unconscious. The clarity of discrimination can once again be clouded over. This temporary loss of the ground attained is one of the predictable obstacles of the path of enlightenment. The way to deal with this is the same as it was before the discriminative enlightenment . In the relaxation of the focus, other mind contents arise in the intervals.  These are based on subtle impressions. The yogi faces failures at every step but he must forge ahead.

4.28- - hanam esham kleshavaduktam

In the same way as the sadhaka strives to be free from afflictions, the yogi must handle these latent impressions judiciously to extinguish them.

The gap between consciousness and the seer can rear disharmony and disturbance in one's self. As fire is deprived of fuel, likewise, the yogi has to remove the latent impressions from the consciousness and extinguish them, for it to be in harmony with the seer. Patanjali advises the yogi to eliminate disturbances by reintroducing yogic disciplines with faith, vigour and vitality. As the sadhaka earlier strove to rid himself of the sufferings of avidya, asmita, raga, dvesa and abhinivesa, the exalted yogi must, through practice, press, dry out and close the perforations in the consciousness. iv. 27 stated that subconscious impressions surface in the form of intellectual pride, which hinders progress towards the goal of union with the divine seer. As roasted seeds do not germinate, so the fire of wisdom must burn out impressions and ambitions, ending their power to generate disturbing thoughts, so that the consciousness maintains its union with the seer forever. Patanjali has taught us all the methods for removal and rooting out of kleshas like ignorance and suffering throughout the Yoga Sutras earlier. The removal of the remaining kleshas also needs to be done by the same methods.  First, you seek enough purity of mind and body that you can experience the highest. Then, after that direct experience, the way in which you relate to samskaras and karma is vastly different. You have glimpsed the highest, and knowing that, the purifying process. One must never accommodate even small errors because they are as detrimental as the five obstacles.  Each yogi has to endure and overcome this inner conflict alone.

4.29- - prasankhyanepyakusidasy sarvathavivekakhyater dharmameghah samadhih

The yogi who has no interest even in this highest state of evolution, and maintains supreme attentive, discriminating awareness, attains dharmameghah samadhi.   He contemplates the fragrance of virtue and justice.

When the stream of virtue pours in torrents and the consciousness is washed clean of bias, prejudice and ambition, the light of the soul dawns. This is dharma megha samadhi - the fruit of the practice of yoga.  If the yogi, knowing that the highest form of intelligence is also a hindrance, remains uninterested even in this enlightened wisdom as well as in spiritual attainments, virtuousness descends upon him like torrential rain, washing away his individual personality. His only ambition now is to sustain spiritual health. He has purity and clarity. His personality has been transformed. He becomes humane, universal and divine. He lives forever in dharma megha samadhi, unexcelled bliss.  A cloud has two facets. It may cover the sky without bringing rain. This makes the atmosphere gloomy and people become inactive and dull. But if the cloud bursts into rain, the atmosphere is cleared, the sun shines, and people go out to work gleefully. The yogi should not make the consciousness quiet in a tamasic way, but in an alert, satvic way to shine forth brilliantly to live in the delightful, fragrant rain-cloud of virtue.  He has renounced everything, and is a viveki (one who distinguishes the invisible soul from the visible world), ajnanin (sage), a vairagin (renunciate), and a bhaktan (divine devotee). Now he has attained nirbija Samadhi.  Omniscience or total knowledge is what man seeks to attain as the highest state possible for him. But, for yogi, even this omniscient state holds no interest at all. He does not hanker for it, nor does he feel proud when he knows he has it. Thereby, the yogi exhibits the highest possible state of discrimination. The Samadhi which he is in, in  this state is called Dharma Megha Samadhi, or the Samadhi of the cloud of virtue. This renouncement of the exalted state of omniscience is called paravairagya or the ultimate renunciation. One can renounce all desires – and go on desiring for moksha. But, one can renounce even this desire for moksha. This is the state of absolute desirelessness. No desires what so ever – no desire even for Moksha. The desire for Moksha, or liberation is the ultimate desire and even this desire is renounced to make desirelessness complete.  This state is the state of the ultimate discrimination. And the yogi will now be in this state forever. Patanjali calls this state as Dharma Megha Samadhi. Dharma means virtues, megha means clouds; Samadhi means the still, flickerless state at the end of dharana and dhyana. This dharma megha is going to remain flickerless and still with the yogi.  Dharma means virtues. All virtues have descended on the Yogi like a cloud from the sky. And, they will now remain still and flickerless with the Yogi. Why is this Samadhi called a cloud? This cloud also covers the vision of the Yogi from the clear sky of kaivalya.  Even if it is of virtues, it still covers the essential kaivalya, his total liberation, from the Yogi. So, to that extent, this too remains as the last barrier that the yogi must come out of. When there is no longer any interest even in omniscience, that discrimination allows the samadhi, which brings an abundance of virtues like a rain cloud brings rain. : There finally comes a point where discrimination has so thoroughly set aside all which is not Self that even the interest in omniscience is seen as only relatively real and not worthy of pursuit. Then comes the highest virtues: From that non-attachment to omniscience there comes the samadhi that brings an abundance of virtues like a rain cloud brings rain. The Self may have been glimpsed before, but the colorings of the deep impressions were still there. Now even those have been transcended. Peace, bliss,  and perfect purity becomes a yogi’s  own nature, after he has  given up all  vanities of powers.

4.30- - tatah kleshakarmanivrittih

Then comes the end of afflictions and of karma.

The effect of dharma megha samadhi is freedom, freedom from the five afflictions and fluctuations. It is the highest form of intelligence and evolution. From this rain-cloud of virtue, sufferings cease of their own accord and in their place, divine actions with no reactions flow forth like a river from the yogi. This is freedom. Avidya, the mother of afflictions, is eliminated, root and branch, along with residual subliminal impressions. The sadhaka will not deviate from the path of divinity nor perform an act that binds, hinders or preconditions his consciousness. He is free from the bondage of karma. In the Bhagavad Gita (V 1.5), Lord Krishna says that each individual has to cultivate himself to become enlightened, and to learn not to degrade himself, for the Self alone is the friend of the individual self, and the Self alone is the enemy of the egotistical self. As the light of a lamp fades as the oil runs out, so the lamp of the mind is extinguished as its fuel, the actions producing joys and sorrows, is exhausted. As nirmana citta is extinguished of its own accord, its root motivation is burnt out, leaving no opportunity for the production of effects The cycle of cause and effect is at an end, and the yogi is liberated from the grip of nature. Even in this liberated state, he will not relinquish his practices. He will continue to maintain them as a divine command, so that the freedom earned may not be lost by neglect. Patanjali says – if the yogi goes beyond even this barrier of virtuous cloud or Dharma megha, then, all the deepest impressions or samskaras in him dissolve totally and all the kleshas or sorrows, pains and afflictions cease totally and absolutely. Dharma megha Samadhi is thus the last barrier to cross for the successful yogi.After that dharma-meghah samadhi, the colorings of the kleshas and the karmas are removed. Burning the seeds of karma: This is the final dealing with the colorings (kleshas). First, the mind was stabilized . Then these colorings were reduced in their gross form , then they were dealt with in their subtle forms. These kleshas (colorings) moved through four stages of active, separated, attenuated, and then were reduced to seed form. Now, those seeds are parched, so as to not be able to grow again. First, there were glimpses of Truth, which had the effect of negating the obstacles . After a great deal of sadhana (spiritual practices), there came a temporary discriminative enlightenment that was accompanied by breaches . Now, with the neutralizing of the colorings of the samskaras that cause karma, the realization is finally firm of ground. The yogi rests in the True nature of the Self . From that samadhi all afflictions and karmas cease. After that dharma-meghah samadhi, the colorings of the kleshas and the karmas are removed. From that comes cessation of pains and works. When that cloud of virtue has come, then no more is there fear of falling, nothing can drag the Yogi down. No more will there be evils for him. No more pains  When the yogi reaches the causal level and sees the various clouds of energy (meghah) in which the dharmas or laws for righteous life, are created and maintained, he gets an ease in his higher yoga practice.  He smiles for he will never again fall into the trap of making spiritual missions to help or to save others

4.31- - tada sarvavarannamalapetasy jnanasyaanantyajgyeyam alpam

Then, when the veils of impurities are removed, the highest, subjective, pure, infinite knowledge is attained, and the knowable, the finite, appears as trivial.

The stream of virtue extinguishes all the veils of impurities. The yogi is devoid of doubts, preconceptions and prejudices. The infinite light of the soul illumines him continuously, and his consciousness and the seer become one. For him, knowledge gained through the organs of cognition and through consciousness are insignificant compared with the infinite wisdom emanating from the soul. This sutra describes the characteristics of the yogi who is devoid of afflicting actions. His head becomes clear and his heart clean and pure as crystal. When the clouds dissipate, the sky becomes clear. When the sun is bright, no other light is required. When the light of the soul blazes, the yogi does not need mind or intelligence to develop knowledge. . In this sutra, as the consciousness has been fully matured, he cautions the yogi that if fissures are formed in the cttta, afflictions will affect him instantaneously and not at a future time. His knowledge springs eternally from the seed of all knowledge (atman) and jnana gahga (perennial river of wisdom), and he perceives directly. The cover that has clouded the Jnanam is now totally removed. It is shining in its pristine purity and totality now.  The Jneyam, the thing to be known is now almost nothing. Or alpam. In this state, the Purusha starts functioning by himself, and mind merely remains without clouding his experience and vision. Purusha sees and experiences the reality totally. There are no barriers whatsoever for him now. It can also be said, he is now the reality himself. Then all the coverings and impurities of knowledge are totally removed. Because of the infinity of this knowledge, what remains to be known is almost nothing. The, when the veils of impurities are removed, the highest, subjective, pure, infinite knowledge is attained, and the knowable, the finite, appears as trivial. Then the whole universe, with all its objects of sense-knowledge, becomes as nothing in comparison to that infinite knowledge which is free from all obstructions and impurities. When the mind is free from the clouds that prevent perception, all is known, there is nothing to be known.  When those veils are only temporarily removed or set aside, the process of purifying continues, recalling that instructions were even given on how to deal with breaches in enlightenment .  First comes the direct experience of the infinite. It might be only a glimpse, but even that glimpse may qualitatively reveal the height of Truth . Then comes knowledge: One of the results of that direct experience is the knowledge of the simplicity of things, that there really is little to know. Then keep purifying: After that realization, we then continue with renewed conviction the process of removing karma, etc. Karma is removed: Finally, all karma is removed through the coming of the rain cloud of virtues described in the previous sutra.  The realization that there is little to know is deliciously amusing, amazing, wonderful, and filled with joy.  These insights come because of seeing the nature of the gunas , the way the subtle mind operates, and realizing the higher discrimination. Then knowledge, bereft of covering and impurities, becoming infinite, the knowable becomes small.  Knowledge itself is there; its covering is gone. 

4.32- - tatah kritarthanan parinamakramapari samaptirgunanam

When dharma megha samadhi is attained, qualities of nature (gunas) come to rest. Having fulfilled their purpose, their sequence of successive mutations is at an end.

Having transformed the yogi's consciousness by the radiation of the rays of the soul, the orderly mutations and rhythmic sequences of the qualities of nature, sattva, rajas and tamas come to an end. Their tasks are fulfilled, and they return to nature. The essence of intelligence and the essence of consciousness both now retire to rest in the abode of the soul. The master, the seer or the soul, is independent. He keeps the gunas in suspension, or uses them when necessary. They enthusiastically serve him as committed servants, without influencing him as before, and without interfering in his true glory. Now the three primary gunas have totally fulfilled their purpose for him. They are no more needed for the enlightened yogi. He has transcended all their use. Ordinarily, the three Gunas are the ones, which go on creating an ordered sequence of events for the sadhaka, which he has to go through all his life.  Now, the Yogi has transcended that ordered sequence of events and transformations. There is no more need for them in his life. He is beyond all the three Gunas. Therefore, having fulfilled their part in his life, the gunas recede back into the essence from which they have come. They, which means, the world of three Gunas, no more undergoes any transformation in the experience of the enlightened Yogi. The Purusha had jumped from the Divine into the world of prakruthi. There he learnt all the lessons that prakruthi had to offer; He was covered by the Maya, of the three Gunas, which were constantly transforming his world. But, as yogi, he began coming out from one barrier after another, set for him by the Maya. The ultimate barrier of dharma megha also having been transcended, the Purusha is back into the divine. The whole prakruthi of the three Gunas, cannot any more, set any barriers for him.  He is now a muktha Purusha. Also resulting from that dharma-meghah samadhi, the three primary elements or gunas  will have fulfilled their purpose, cease to transform into further transformations, and recede back into their essence. The interplay of the three gunas were earlier seen to be the cause for pain , and sadhana was done so as to discard this pain before it comes. The coming of the dharma-meghah samadhi also brings to an end the need for the three subtle transitions previously discussed . Thus, the subtle material nature, having fulfilled its purpose, its progressive alterations end. When dharmameghah samadhi is attained, qualities of nature (gunas) come to rest. Having fulfilled their purpose, their sequence of successive mutations is at an end. The three basic qualities cease to follow the sequence of alternating pain and pleasure.  Resulting from that dharma-meghah samadhi , the three primary elements or gunas  will have fulfilled their purpose, cease to transform into further transformations, and recede back into their essence.

4.33- - kshannapratiyogi parinamaparantanigrarhyah kramah

As the mutations of the gunas cease to function, time, the uninterrupted movement of moments, stops. This deconstruction of the flow of time is comprehensible only at this final stage of emancipation.

The sequence of time is related to the order of movements of the gunas of nature. Only the yogi recognises this inter-relationship and is free from gunas. The uninterrupted succession of moments is called time. These movements of moments and the uninterrupted mutation of the gunas of nature are distinctly recognisable at the culminating point of transformation. The average person is not aware of moments - he understands their movement as past, present and future. When moments sup away from one's awareness, one lives in movements. Memory begins to exert its influence, and consciousness is felt at this juncture in the movements of time. The perfect yogi lives in the moment without getting involved in movements - the movements of moments are arrested, and psychological and chronological time comes to an end. Living in the moment, the yogi sees the seer. This is evolution. Nature eternally helps the intelligence and consciousness towards evolution (parinama nityan), whereas the seer remains eternally changeless (kutastha nityan). Evolution takes place in a moment. Moment implies instant while movement implies time. When change comes, it arrives at once in a moment, only after a series of efforts involving movements of time. Transformation does not come without effort. As change is noticeable to an average individual, so the end transformation is distinguishable to a yogi by virtue of his pure wisdom - dharma megha samadhi. He is free from time, place and space, while others remain trammeled in this net. He is neither attracted towards nature nor disturbed by it. He is now a divine yogi. Every change is clearly perceived only at the end of the transformation process. Not, when the change was happening from moment to moment. It is true that each moment presents a point of change in any ordered sequence of changes. But, the perception of the change is really clear, only when the sequence ends. All the three Gunas need to undergo the full change  - and then, the full change becomes comprehensible. This implies two things. (1) Every moment a part of the total change is taking place. But, in that moment, the change is not comprehensible. (2) At some point, a total change has been completed – and it becomes perceptible and comprehensible. For the Yogi, the three Gunas have stopped their transformation process. This means, the total change is visible, experience-able, and knowable for the Yogi. But, the same has not happened for all others. For all others, the change continues; the transformation continues; and every moment, there is change; they are not able to see the change that will come tomorrow. But, not so, for the yogi who has gone beyond the dharma megha Samadhi. For him, there is no further transformation, which is hidden from him.  All changes are known to him. The sequencing process of moments and impressions corresponds to the moments of time, and is apprehended at the end point of the sequence. Here, in this sutra, time is being described as the uninterrupted sequence or order of the many impressions in the field of mind. It is this sequencing that brings the appearance of time. Think of a reel of movie film. You can hold it, and all of the frames in your hand, at one moment of time, and yet, when you play the movie through a projector, you create the appearance of time. It is because of the sequencing of the frames, one after the other, that there appears to be time. The "Aha!" moment of understanding a sequence of moments, impressions, or frames comes at the end of the sequence. Recall that great emphasis is placed on these transition moments in sutras. When you can see these moments at the end of the sequence, you come to understand the transformation process itself, and can see beyond the avidya or ignorance that veils the true self.  Break the pattern of sequencing to transcend time: Most of the time, we are caught up in time, identified with those thought patterns, whether gross or subtle in nature. Now, in these last few sutras, all of those patterns have been reduced to their primal reality, that of the three gunas. If you break the identity with the patterns, and the sequencing process, then you break the process of time, space, and causation. The process, of which moments are a counterpart, and which causes the alterations, comes to an end and is clearly perceived.The advanced yogi alone achieves this.  This is an individual accomplishment, where the yogi sees the moments, which in sequence make up time which is itself the changing mundane energy (gunanam).  The yogi clearly perceives this from afar.  What hypnotizes other and keeps them under its control subjectively and objectively, is looked upon by the yogin, just as the God would normally see it.As the mutations of the gunas cease to function, time, the uninterrupted movement of moments, stops. This deconstruction of the flow of tie is comprehensible only at this final stage of emancipation. This is the sequence of the mutations which take place at every moment, but which are only perceived at the end of a series.  A sequence is the replacement of one characteristic by one that follows it. This is linked to moment. A replacement of characteristics is also the basis of moment.

4.34- -- purusharthashoonyanan gunanan pratiprasavah kaivalyan, svaroopapratishtha va chitishaktireti

Kaivalya, liberation, comes when the yogi has fulfilled the purusarthas, the fourfold aims of life, and has transcended the gunas.

The yogi with the stream of virtuous knowledge is devoid of all aims of life as he is free from the qualities of nature. Purusarthas are man's four aims in life - dharma (science of duty), artha (purpose and means of life), kama (enjoyments of life) and moksa (freedom from worldly pleasures). They leave the fulfilled seer and fuse in nature.  Patanjali speaks of the purusarthas only in the very last sutra. His thoughts on the purusarthas are implicitly contained in the earlier chapters, and expressed clearly at the end. Thus, the four padas are, consciously or unconsciously, founded on these four aims and stages of activity.  Dharma is the careful observation of one's ethical, social, intellectual and religious duties in daily Life. Strictly stating, this is taught at the level of studentship, but it must be followed throughout life; without this religious quality in daily life, spiritual attainment is not possible.  Artha is acquisition of wealth in order to progress towards higher pursuits of life including understanding the main purpose of life. If one does not earn one's own way, dependence on another will lead to a parasitic life. One should never be greedy while accumulating wealth, but only to meet one's needs, so that one's body is kept nurtured and one may be free from worries and anxieties. In this stage one also finds a partner with whom to lead a householder's life. One comes to understand human love through individual friendship and compassion, so that one may later develop a universal fellowship leading to the realisation of divine love. The householder is expected to satisfy his responsibilities of bringing up his children and helping his fellow men. Thus, married life has never been considered a hindrance to happiness, to divine love or to the union with the Supreme Soul.  Kama means enjoyment of the pleasures of life, provided one does not lose physical health, or harmony and balance of mind. The Self cannot be experienced by a weakling, and the body, the temple of the soul, has to be treated with care and respect. Asana, pranayama and dhyana, therefore, are essential to purify the body, stabilise the mind and clarify the intelligence. One must learn to use the body as a bow, and asana, pranayama and dhyana as arrows to be aimed at the target - the seer or the soul. Moksa means liberation, freedom from the bondage of worldly pleasures. It is the experience of emancipation and beatitude, possible only when one is free from physical, psychological, intellectual and environmental afflictions , and from poverty, ignorance and pride. In this state one realises that power, knowledge, wealth and pleasure are merely passing phases. Each individual has to work hard to free himself from the qualities of nature (gunas) in order to master them and become a gunahtan. This is the very essence of life, a state of indivisible, infinite, full, unalloyed bliss. These aims involve virtuous actions and are linked with the qualities of nature and the growth of consciousness. When the goal of freedom is attained, the restricting qualities of consciousness and nature cease to exist. At this point of fulfilment, the yogi realises that the seeker, the seer and the instrument used to cognise the seer is atman. This absoluteness of consciousness is nothing but the seer. Now, he is established in his own nature. This is kaivalyavastha.  The practice of yoga serves every aim of life. Through the proper use of the organs of action, senses of perception, mind, ego, intelligence and consciousness, their purpose of serving their Lord, the seer, comes to an end, and these vestments of the seer, along with the qualities of nature, coil and withdraw, to unite in the root of nature (mula-prakrti).  There, they are held and isolated. By this, the citta becomes pure and supreme. In this supreme state, citta divinely merges in the abode of the seer so that the seer can shine forth in his immaculate, pure and untarnished state of aloneness. Now, the yogi shines as a king amongst men. He is crowned with spiritual wisdom. He is a krtarthan - a fulfilled soul, who has learned to control the property of nature. He brings purity of intelligence into himself. He is now free from the rhythmic mutation of gunas, of time, and thus released from aims and objects, as his search for the soul ends. All the twenty-four principles of nature move back into nature and the twenty-fifth, the seer, stands alone, in kaivalyam. He is one without a second; he lives in benevolent freedom and beatitude. With this power of pure consciousness, citta shakti, he surrenders completely to the seed of all seers, Paramatma or God. Lord Krishna, in the Bhagavad Gita (XVIII.6I-62), explains that 'the Supreme Ruler abides in the hearts of all beings and guides them, mounting them on wheels of knowledge should seek refuge by surrendering all actions as well as himself to the Supreme Spirit or God' so that he journeys from Self-Realisation towards God-Realisation.  Patanjali began the journey towards the spiritual kingdom with the word atha, meaning 'now'. He ends with the word iti, meaning 'that is all'. The yogi has reached his goal. The whole drama of the world goes on due to the emergence of the three gunas (or prakruti) as the coverage or aavarana around the Purusha – making him dance with the mind-field and its vrittis. Now, they have resolved back into their original form into the prakriti, leaving the Purusha free from the covering, or from the barriers created by them. The Chitta vrittis were the barriers. Purusha has scored a total victory over them now. Therefore, the three Gunas resolve back to their original position in the Prakriti. The yogi has conquered the chitta vrittis completely. He is now liberated from all of them, totally. He has emerged enlightened . He is now established in his original nature. This is kaivalya. When those primary elements involve, or resolve themselves back into that out of which they emerged, there comes liberation, wherein the power of pure consciousness becomes established in its true nature. When those primary elements or gunas involve, or resolve themselves back into that out of which they emerged, there comes liberation, wherein the power of pure consciousness (purusha) becomes established in its true nature . Such an enlightened Yogi is purely spontaneous, with no actions whatsoever being motivated by the inner drives of samskaras and karma. One hundred percent of actions are from the here-and-now response to the needs of the moment, in relation to the service of other beings. This is easy for such a yogi, as there is no I and no other; it is all a constant flow of pure, undivided consciousness (purusha), that only seems to play, here, there, and everywhere. Kaivala, liberation, comes when the yogi has fulfilled the purusarthas, the fourfold aims of life, and has transcended the gunas. Aims and gunas return to their source, and consciousness is established in its own natural purity. Since the gunas no longer have any purpose to serve for the Atman, they resolve themselves into Prakriti. This is liberation. The Atman shines forth in its own pristine nature, as pure consciousness. When the highest purpose of life is achieved the three basic qualities do not excite responses in the mind. That is freedom. In other words, the Perceiver is no longer colored by the mind. When those primary elements involve, or resolve themselves back into that out of which they emerged, there comes liberation, wherein the power of pure consciousness becomes established in its true nature. 

Here ends the exposition of kaivalya, the fourth pada of Patanjali's Yoga Sutras.  

Patanjali Maharishi covered everything in the mystic practice of yoga.  All glories unto him.  

Hari!Om! Namaskaraha, Great Mr. Captain Sir, Very interesting and enlightening blog, yours. Best Wishes. I have to go through in depth and detail to offer views etc.

  1. hi vc,















    capt ajit vadakayil


kancha ilaih SQUEAK nay shephard came on TV couple of years ago.

he was cracking up from within-- his voice quivered with sheer grief when he cried--THESE HINDU GODS ARE SO VIOLENT, THEY ARE ALL THE TIME KILLING PEOPLE

to this SQUEAK i must say " hindus gods are all cosmic allegories except vishnu avatars "

stop moaning that Brahmins did NOT allow shudras to learn vedas – this would be as irresponsible as a brain surgeon allowing his nurse to do brain surgery on a holiday .. vedas went on the oral route for 300 centuries, without losing a syllable , before they were penned down 70 centuries ago ..

devdutt pattanaik who does NOT understand sanatana dharama comes on TV serials aand denigrated hindusim.

he thinks that hindu gods are mortals , and their vahanas ( vimanas ) animals and birds.

see the way amish tripati converted shiva to be a tribal sex started mortal and the white man loved him for it.

devdutt pattanaik's attitude towards hinduism can be gauged from the post below--

read the part n blue italics- where shiva is hiding from nandi bull who is waiting in ambush to rape shiva anally . . . reciprocation if you please . .
if he did the same in saudi arabia to islam he would have been beheaded on the streets within an hour.

this blogsite asks TIMES OF INDIA e-newspaper to stop denigrating Hinduism daily vide its SPIRITUALITY COLUMN.

devdutt pattanaik must know there is no heaven and hell in Hinduism.

somebody asked me about old people-- even from kerala-- going to KASHI GHATS to die.

well in olden days due to the saraswati river underground component, there was a MOBIUS COIL water flow at the ghats . people whose souls departs from this massive SCALAR FIELD gets a boost of ONE astral layer

same with kailash mountain-- pandavas walked to mount kailash before they died.

pyramid shaped mount kailash has an ORGONE FIELD due to the golden mean of 1.618 .



capt ajit vadakayil




All the BHAKTI MOVEMENT HEROES are FAKE and backdated creations of Jew Rothschild who ruled India —the most famous being the DASA characters .

Jew Rothschild’s historians LIED that Bhakti movement was a revival, reworking and recontextualisation of ancient Vedic traditions..

In Sanatana Dharma the six virtues are Sama, dama, uparati, titiksha, SHRADDHA and samadhana..

Lord Krishna also gives importance to Shraddha and says in the Bhagavad Gita:--

One who has Shraddha ( not BHAKTI ) gains knowledge.

Shraddha hrudayya yakutyaa shradhayaa vindate vasu. --(Rig Veda 10/151/4) 5000 BC.
Meaning: Shraddha (faith) is the symbol of the high sentiment of the heart.

Shraddha cannot be aptly translated into English. Loosely put, it may be be called faith / trust.

Your willingness to know the unknown is shraddha...shraddha is not blind faith, but enlightened faith based on verification.

If your mind is fixed, and says “That’s it. I know it all”, that is ego. The more you know, the more will be the feeling that you don’t know. Recognition of the unknown is Shraddha....

Shraddha means unwavering faith in the sacred scriptures or shastras and in the moral codes they contain as well as in the atma ( soul )...

The shastras are designed to ensure the peace and prosperity of the world and the spiritual perfection of mankind..

This is not blind faith like is SINGLE MESSIAH, SINGLE HOLY BO RELIGIONS...

It is based on accurate reasoning, evidence and experience. Then only it can be lasting faith. Then only it can be perfect, unshakeable faith....

Superstitious beliefs, beliefs in mere religious traditions ( like AGAMA ) or social customs cannot help one in spiritual advancement......

No spiritual progress is possible without shraddha. ..From shraddha comes nistha or one-pointed devotion and from nistha comes self-realization. If the faith is flickering, it will die soon and the aspirant will be drifted aimlessly hither and thither...

Ancient maharishis talked about the quality of “shraddha” which is a positive energy that comes from within. ..

Shraddha should not be translated as a “simple” faith / trust, --it also conveys mental and intellectual firmness...



In the opening verses of the 17th chapter OF Bhagwad Gita , Krishna says that faith results from our most steadfast convictions.

When our mind is pure, he says, we find faith in benevolence, having little attachment to what we ourselves can gain.

At such times, faith leads us to value yoga as a means for curtailing sorrow and suffering, and for directing our mind toward transcendental truths.

Yoga itself is an act of faith arising from the heart, and by having faith in the fundamental aims of yoga, “a faithful person obtains knowledge.” (Bhagawad Gita 4.39- 4000 BC)

A Hindu free of BHAKTI dogma ( like in other single holy book religions ) is skeptical when this question of trust / faith arises because faith is always understood to be blind faith.

Shraddha is more than mere faith. It also implies self–reliance, an independent sense of right and wrong, reliance on conscience and the courage of one’s own conviction







    No guru wants his students to believe; he wanted his students to understand and agree . A teacher wants students to understand, to know, unlike a SINGLE HOLY BOOK DOGMA preacher who wants listeners to believe.

    A physics professor doesn't want his students to believe in atoms; he wants them to understand. In the same way, Hindu Gurus and spiritual texts do not command you to believe; they lead you to understand.

    The goal, as understood by the ancient rishis, is not to merely believe in God, but to know God directly.

    Shraddha is the first step in one's search for God. In the fourth chapter of the Bhagavad Gita, Sri Krishna says, "shraddhavan labhate jnanam, one with shraddha gains knowledge.

    Check out the FAKE Bhakti movement heroes-- 12 Alvars , 63 Nayanars, Andal, Basava, Bhagat Pipa, Allama Prabhu, Akka Mahadevi, Kabir, Tulsidas, Kabirdas, Kalidas, Ramdas, Chandidas , Surdas , Ravidas, Gusainji, Ghananand, Ramananda Sripadaraja, Vyasatirtha, Purandara Dasa, Kanakadasa, Vijaya Dasa, Six goswamis of Vrindavan , Raskhan, Jayadeva Goswami, Namdev, Eknath, Tukaram, Mirabai, Ramprasad Sen, Sankardev, Vallabha Acharya, Narsinh Mehta, Gangasati,Chaitanya Mahaprabhu etc etc .






    Capt ajit vadakayil















    The GRAVE implication is, WE COLLEGIUM JUDGES CONTROL INDIA. . . Almost all media barons run their own foreign funded NGOs and they can trigger violent riots and then get the collegium judge to ACT AND JAIL ANYBODY . .



    punch into Google search -- -
    . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .

    capt ajit vadakayil


    WHEN DID --








  3. Namastey captain
    Over 65 Percent of U.S. Has Unsafe Levels of Toxic Chemicals in Drinking Water

  4. Dear Captain,

    Reading your blog has become ritual, like morning prayers. :)






    2. My morning newspaper is Ajitvadakayil blogspot


    3. Yooooo CAPTAIN,

      This is eternal truth millions would agree this in silence that they read your blogs 1st thing in morning. No doubt about it...












    2. How captain??

      what happened??


  6. Respected Captain Vadakayil
    Prashant Bhushan's NGO Common Cause has filed a petition in Supreme Court saying that sedition law is being used against activists to scuttle dissent. We are sick and tired of this anti-national traitor who is on payroll of foreign forces.

    1. WELL --





      it is high time some foreign controlled collegium judges are thrown into jail

      capt ajit vadakayil




  8. Pranaam Captain

    please explain about the Great Trigonometrical Survey of Indian sub continent did by the Rothschild agent Geroge Everest and british ,it is George everest who gave away the Hindu logic to Charles Babbage ,

    whats the mystery behind the goragaands obsession with Himalayas ? did they use Radhanath Sikdar as puppet to steal the ancient hindu scriptures ?
    what is this miracle of Non isostatic state of Himalayas ?

    1. Captain please reply ,why the british conducted Trigonometrical Survey ? what was their ulterior motive ?



  10. Captain,

    Devdutt's article on how a Shiva Linga is a symbolic worship of a phallus.



































  19. Sir the Kerala new year which is being celebrated today is authentic or fake injected by white invader stooges .

    some of my kerala friends are saying that today one is authentic. I told them it is other way .

    Please clear the confusion sir


  20. Captain sir,
    What do you think about our defence m Parrikar does he have the thing in him. Or just fooling us

  21. Namastey captain
    Rothschild’s era

  22. Pranaam Captain Saab,

    Dhanyavaad from my heart for all the profound truths revealed in your Sanatan Dharm blogs, also express gratitude to Rishi Patanjali.

    upon reading it i am reminded of following ....Mughal emperor Jahangir set his eyes on the valley of Kashmir. He said that if paradise is anywhere on the earth, it is here. When i instinctively realize the wisdom revealed in the Sanatan Dharma posts, this thought comes to my mind..if ever there was truth revealed on earth ..this is it this it..(i have read lot of material, but when i read your posts, i feel like going into deep dhyana, forgetting the external world).

    A sincere appeal to all the readers, please please find time from this material world and intellectually & spiritually comprehend & understand why exactly our great Captain Ajit has spent time , effort & mind to bring us the profound wisdom of Patanjali yog in simple easy to understand language. Like a wise Guru our dear Captain has our well being at heart. I wish Captain would start an Ashram to guide all the followers in true Sanatan Dharm, so that true Satyug would prevail on earth. and i know deeply captain would not get any material benefit out of this , unlike the other sham Gurus.

    May Parmatma bless our Captain with good health and well being so he can keep guiding us lost beings born in this confusing Kalyug.

    Best regards,

  23. An appeal to all youth of Bharat, Captain Ajit has revealed a science which is so valuable more than all the gora oriented education hifi degrees which are youth are so crazy about. This science revealed by Patanjali is the ultimate..amazingly formed in our great ancient bharat, to beat even the modern human created sciences of the goras. This goes to very depth to solve human condition, and not the superficial material sciences of the goras which only bring material comfort but destroys us from within. So leave all your distractions of modern life and pay attention to what Captain is saying.

  24. Captain is like the wise Charioteer who is guiding us on the right path, away from malicious, distractive, disruptive & exploitative forces which want to dissipate our consciousness within. Captains Sanatan dharma blogs are like a beacon of light in this stormy sea of samsara, guiding it passionately with interest like as its your last hope, a how do to manual to rescue you from the stormy seas of maya.

  25. Islamist Terror in Pakistan and Religious Minorities -

  26. PV Sindhu vs Wang Yihan Highlights Rio Olympics

  27. Dear Sir, need your blog n views on treatment of water, specially on Jamnagar project, very recently Dr Swamy praised of this work.. My doubt is, will the govt take water supplies from plant production for their own consumption? Or can such water be exported to first world instead of the water from our holy rivers. I know you mentioned in one of your comment that this will have a bad affect in health as water holds memory. Please see if you can further explain this topic in a blog as only you can understand chemistry n who is sponsoring this work

    In anticipation of your response







  28. Hi Captain,

    Deeply saddened, pls watch this video how our desi gaumata is picked up from the street of gujarat for beef export the car has gujarat number plate and this happened 2 days ago, i dont know whom to protect holy cow or these so called non (dalits) i insist u must say something.





  29. Hari!Om! Namaskaraha, Great Mr. Captain Sir, Very interesting and enlightening blog, yours. Best Wishes. I have to go through in depth and detail to offer views etc.

    1. hi vc,

















      capt ajit vadakayil

  30. Namastey captain
    Finally we arrived. .india got broonze.
    Sakshi sister ,we are proud of u .
    Happy rakshabandhan

  31. Dear Captain,
    Can you post on Avani avittam and significance of poonulu






















    The GRAVE implication is, WE COLLEGIUM JUDGES CONTROL INDIA. . . Almost all media barons run their own foreign funded NGOs and they can trigger violent riots and then get the collegium judge to ACT AND JAIL ANYBODY . . .. . .


    punch into Google search -- -
    . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .

    capt ajit vadakayil

    1. British rule was the golden era in Indian History
      1. British unified over 550 princely states into a single entity.
      2. They ended Moslem domination in India and liberated Hinddus from 1000-year long subjugation that eventually led to the rise of Hinddu intellectual class who could eventually fight for the freedom of India.
      3. Britishers built excellent dams, bridges, railways, raods, etc which unheard in the rest of Asia (during 19th century).
      4. British opened many universities and colleges in India, which helped Hinddus to rise as an intellectual class.
      5. British introduced English helped India to become a software superpower in the world today.
      6. British rule considerably weakened the barbaric caste-system, even though remnants of the system remain. Even superstitions decreased to a great extent.
      7. Due to better medical services, death rate dropped and birth rate increased.
      8. British rule altogether gave a new direction to Indians who were mired in ignorance, superstitions, caste-barbarity and opened an era of modern civilization in India.

    2. YEH LEH--





    3. Quote 1. British unified over 550 princely states into a single entity. Unquote

      In Mahabharat (4000 BC) , Shri Krishan DECLARES - '' Whenever and wherever there is a decline in religious practice, O descendant of Bharata, and a predominant rise of irreligion – at that time I descend Myself.''(Rough Translation)

      So, which one of those princely states was named 'Bharata'?

    4. @ Retard oh sorry Rishab

      British destruction of India

      Famines -

      “From about the beginning of the eleventh century to the end
      of the eighteenth there were 14 major famines in India.” This
      is roughly two per century. Under the period of East India
      Company rule from 1757-1858 there occurred 16 major famines,
      a rate eight times higher than what had been common
      before. Then, under the period of British Colonial Office rule
      from 1859 to 1914, there was a major famine in India an average
      of every two years, or 25 times the historical rate before
      British rule!

      The drain of wealth from India based on a tax-farming system, the destruction of native textile industry by the “free market” dumping of British textiles, and the plantation economy of opium, led eventually
      to a fierce resistance from the communal based population.

      National Income of India --

      Under Mughal rule

      India’s economy had in 1600 a 28.9% share of world
      India’s economy had in 1700 a 24.5% share of world

      Under British India National Income was

      1870 9.2% share of the world
      1913 2% share of the world

      India lost its great skills like the nano technology steel it had

      The development projects like Railways were done by British for their own benefits. They cant carry Indian natural resources from jungles on elephant backs, so they needed railways for such reasons. Same with other things they did.



    7. GB Abhinav Kashyap, i would like to correct you, Britishers did not do any good for India but DE-Industrialized and de-developed India, stole all our Indian inventions and Technology and claimed it as their own, britishers or any White Man Do not have any morals, India was industrialized way before the so called Industrial Revolution, the so called industrial revolution started after de-industrializing India and De-developing India and stealing all our Indian Inventions and Technology

      "Indians have Brains too" LOL when did the White Man have brains?, the White Man never had brains, White Man has only stolen all our Indian inventions and technology from INDIA, We Indians are way way smarter than Whites. that is why science fields in the WEST are vigorously Dominated by INDIANS and not by White People. White People cannot calculate simple Maths in their heads how is it even possible for them to invent anything? whereas here in INDIA our 5yr old or 6yr old children calculate Maths at lightning speed.

      it is impossible for people with low intellect( White People) to invent first when compared with people with extremely High Intellect( us INDIANS )

      Truth will hurt many, let it hurt, enough is enough, enough LIES and evil fake Propaganda against INDIA.

    8. hi Prakash I m Not anti India.I wanted to correct Rishab for what he said.Please don't mistake me.This Rishab thinks that British empire looted our Country India.BUT WHO CONTROLLED BRITISH EMPIRE IT WAS JEW ROTHSCHILD.I WANTED TO CONVEY THIS TO RISHAB.I ALSO ACCEPT WHATEVER YOU SAID THAT 'S TRUE THEY(BRITISHERS) STOLE OUR TECHNOLOGY AND EVERY VALUABLE THINGS FROM OUR COUNTRY.


    9. Rishab's views are like from a Britisher. However, we need the true views of India from an unbiased lens. If we need to give views on England or West, that may be:
      1. Britishers and Europeans were the most greedy lot on earth.
      2. They were the most deceptive people on earth.
      3. They came here for purchasing goods, but sold their "Gori Chamadi" to Indian Kings.
      5. the education system in India was gurukul based and was free for all. The rabid Gora-people have seen money there too and introduced the current education.
      6. The systematic Gurukul system of education and research was best in the world as that was based on the need of locality, society, state and world. The main objective of education was to live in coherence with nature and understand natural laws for the benefit of nature.
      7. Gora people, the most greedy materialistic people, who dont care about the nature or ecosystem, picked the alike people from India and made them leaders of state to work as stooge for them. This has systematically destroyed indigenous education system.
      8. Science and technology of West is nothing when we compare with the science of India where people were taught to control living as well as non-living beings using the mental or quantum plasma vibration codes aka Mantras.
      9. 550 princely states were all joined together with one soul and that is "Bharat"
      10. Musilms were subdued by Britishers - No. They have splitted India into many parts. Muslims were of no match to Indian knowledge. The power of sword is nothing when it is compared to power of Yoga. One example - "At the time of Alauddin Khilji, there was so many violence and atrocities over Hindus. The brahmins of Varanasi prayed to Swami Ramananda to look into this matter. He just blown the Shankha for 5 minutes, and there was no Namaaz for 3 days all over the world!!! Do you imagine the power of Yoga? The throats of all the Muslims were choked and they could only breath and drink. nothing else they could do for 3 days. Then their Kazis fell over the foot of Ramananda and Khilzi was also subdued."
      11. Britishers have made all inventions for the sake of Money only. They never cared about the nature.
      12. Britishers have abolished Casteism to a great extent - No. Instead they used the casteism to rule for a longer time. Casteism is a morbid side-effect of absolutism of kings and rulers. This is everywhere and even in worst state. Why Trump has won the election? Iis it not the age-old hidden hatred against some caste/race, that got manifested in the last US election. If you want to remove casteism - you need to remove gaps in intelligence and can that be removed? The pride of intelligence is the root cause of casteism and this is nature's program which is got corrupted by greedy men. That is why Lord Krishna in Gita says about Karma-based division of varna.

    10. hi ad,





      In Sanskrit achintya means 'inconceivable', bheda is 'difference', and abheda translates as 'non-difference'.

      FAKE Swami Ramanuja used to preach in front a bestial sex stone mural ( a dog servicing a woman ) at Srirangam which the saint Ramanuja found very very normal.



      ( Sri Ranganathaswamy Temple, Srirangam, Tiruchinarpalli youtube video )


      Twice a year, a coat of camphor, sandal paste mixed with saffron, which produces a ochre tint is applied on the preserved body ..His body is placed behind his idol --this is NOT allowed in sanatana dharma--it is beyond blasphemy ..





      capt ajit vadakayil

  35. Dear Captain,
    Please accept my heart felt gratitude for your recent blogs on Patanjali. My best wishes to those here whose curiosity for knowing the limits of perceivable knowledge and beyond, are aided by the wisdom of our ancient texts and Captain's selfless narrative of the same. I pray that we all pay attention to each of our inherent karmic pursuits for this life and when the time comes, we can devote time to immerse ourselves in getting rid of our vices and start walking down the path of emancipation as far as this life takes us. Cheers!





  37. Pranaam Captain

    is चतुष्कोटि Hindhu or Buddhist logic ,where was it first mentioned ?

  38. Sir,
    recent statement of M.kaju about mallus shows that he ogles this blog site regularly...:)
    Bharat Matha ki jai.









    " Following her bronze, Malleswari stated that she was disappointed on missing out the gold medal. According to her, a miscalculation on the part of her coaches had seen her lift 137.5 kg in her last attempt to be gold medal contention. Even if she had lifted 132.5 kg she could have won gold; to this day, Malleswari maintains that gold was in her grasp."





















    1. captain,
      enlighten us regarding comrade Bhupesh Gupta who spent a lot of time in Rajyasabha and later died in Moscow.

  46. Murthy is Back!



  47. richard williams took his two small daughters to a US tennis academy.

    These two black , unattractive girls drew sarcasm from all. because tennis was a snobbish white woman's sport

    Stung by the ridicule, Richard prophesied --


    unble to take the taunts, he started coaching them at home

    what is the result ?


    Venus Williams became the World No. 1
    Venus won seven Grand Slam singles titles
    She has 14 Grand Slam titles in women's doubles and two in mixed doubles.
    Williams won four Olympic gold medals.


    Serena Williams became world no 1
    Serena holds the most major singles, doubles, and mixed doubles titles combined amongst active players, male or female.
    She has a total of 22 Grand Slam singles titles
    Serena won four Olympic gold medals.


    capt ajit vadakayil

  48. Capt., Akshay Kumar has Canadian citizenship. So all his patriot talk is farce. Another wolf in sheep's clothing?

  49. Mr.Vadakayil, Read many of your posts. You write there was a gotra system introduced for Brahmins. Doesnt it explicitly state that Brahmins were based on birth? Why are you silent on this issue? Many post on Sanatan Dharma have passed by. Shouldnt you talk about the caste system? Wasn't it the reason for discrimination towards Karna? Do you have something to say about this? Or would you just filter my comment as one from Gora Gaand or Pickle John? Caste system has been one of the most important fundamentals of our Indian civilization. Why dont you reveal the truth about it which you already know?


    2. There isnt any caste system in Indian civilization. Captain has explained this in great details in past blogs. None of ancient Roman/Greek texts on India mentions about caste.

      There is only a varna system. Which is different because it is decided by your birth chart. And its main objective is tell you what kind of work is best for you take up in life.

      Think about this. Surya has a kashtriya varna. But the varna of his son shani shudra. Whiy would this happen if there was a caste system?


  50. Hi Captain,

    It seems like Congress no more cares about the opinion of people. They are hell bent on grabbing the bulk votes of Muslim vote bank by hook or crook even if it means undermining India's National Security.

    Digvijaya Singh says Kashmir is an Indian Occupied territory. This comes just after when Salman Khurshid indirectly said PoK doesn't belong to India. Mani Shankar not too long ago went for pakistan begging them to oust PM of India.

    Congress Leaders have been making such Anti-India statements recently in support of Pakistan (almost as if they are spokespersons of ISI) just after PM Modi spoke in support of PoK, Baluchistan and Gilgit Baltistan.

    ISI are using Congress leaders to express Pakistan's view and these senior Congress leaders are undermining India's National Interest.


    Digvijay Singh terms Kashmir 'India-occupied Kashmir'


    One cannot understand why Hearts of Congress leaders bleeds for Pakistan and not for Hindustan. Congress party have NIL (Zero) Desh Bhakti in it. Not even one single congress leader looks like he / she truly cares for Mother India.

    As long as the party remains an Italian Occupied Congress, it will only have leaders who are corrupts, criminals, thugs, looters, scoundrels, plunderers, pseudo sickulars, selfish traitors, anti-nationals, jaichands, desh drohis who doesn't care for India but care only about themselves.

    Govt must investigate why patriot Col Purohit was tortured by Hemant Karkare and why was late ex ATS Chief Karkare was in constant touch with Digvijaya Singh ? Congress coined the word "Saffron Terrorism" and Congress have time and again tried to Bail Out Pakistan despite having concrete proof of Pakistan sponsored Terrorism in India.

    Govt must investigate why Congress is afraid of Pakistan and why ISI is controlling Congress leaders.

    It almost seems like Congress rule between 2004 - 2014 was NOT actually a Congress rule, but Pakistan was indirectly ruling India for 10 Years using Congress as proxy.








    WE WANT 50% MEN IN NCW . .









  55. Capt. One of my colleague has end stage liver cancer 11cm tumor and growing. He has consulted the best hospitals for treatments without any success. Can you suggest ayurvedic center where he could be treated. Thanks

  56. Hi Captain,

    Wrestler Narsingh Yadav (who had a bright chance of winning Gold medal in wrestling) won't be playing at Rio Olympics and he has been banned from Olympics for 4 Years by World Anti-Doping Agency WADA.




    Many feel its a Foul Play and Conspiracy by jealous west who dominates IOC and WADA who wants to retain their top 3 spots at any cost by not letting good athletes of other nations play.

    They did this foul play with Russia as well and putin was pissed off too. Pole Vaulter Yelena Isinbaeva was banned as well. Isinbaeva's speech against this Injustice almost made Putin shed tears.

    Corruption and Nepotism in Indian Sports Franchise has wrecked havoc on India's Olympic Dreams. Unlike Cricket which is only played by 10 nations, Olympics which is participated by almost 200 Nations needs investment, focus and support from the Government.

    China which has invested on athletes and setting up of proper infrastructure is now at 3rd place and soon they may overtake USA and UK in future Olympics while India is far behind at 71st position.

    Though BCCI has thousands of crores in its kitty, it won't spend even single paisa to develop other sports in India. If 125 Crore people of India spends just 1 rupee for 5 years (625 Crores), india will have a lot of money to develop a great sports infrastructure all over India and invest on good deserving athletes too.

    It is a shame if a nation like India with 1.25 Billion people do not manage to win even 1 single Gold Medal at Olympics. Politicians and Corrupt Bureaucrats in Sports Ministry don't seem to be interested and they don't realize what is at stake is India's Respect, Pride, Honour and Glory.


    why is MODI allowing israel access to our SU-30mki to israeli pilots , jews will get information about our mki's avionics and give it to pakistan through their crypto jew saudi rulers . Kindly explain what is apco modi upto.












    1. i observed and i know you have observed that too that these post are mostly by those 2 girls Nikita Sawant & Namrata D'souza...i guess they themselves need some basic moral education...And you are one who can give that

  62. Namastey captain
    Now another sc judgement of mumbai against Hinduism ritual dahi handi.
    Its serious to democracy and interfering in unconstitutional sections.

  63. Captainy, i hve been recenlty been confirmed to have chron's disease. Im the first person to have this disease. Do you suggest anything to cure or push this disease in to remission. Thank you captain

    1. hi dk,

      become vegan

      consume virgin coconut oil and fresh turmeric in your diet

      eat only freshly cooked food.

      keep away from GM foods, processed foods, and milk of humpless jersey cow.

  64. See page 15 of Toilet Paper today - full of Dalit uprising news! Looks like Toilet Paper wants to stage a revolution by dividing Hindus! It is high time this paper is brought to book!


    2. @ Gama pada only way to stop this hopeless paper and its knowledge is stop buying this paper..that will bought this paper to history

  65. Sir,

    As always, am grateful to you for educating us with truth through your eye opener blogs.

    My 5 yr old has a weak eyesight. Doctos are recommending wearing glasses. Are there any proven home or natural remedies that can help her gain her normal 20/20 vision back?

    Thank you so much

  66. Sir,

    As always, am grateful to you for educating us with truth through your eye opener blogs.

    My 5 yr old has a weak eyesight. Doctos are recommending wearing glasses. Are there any proven home or natural remedies that can help her gain her normal 20/20 vision back?

    Thank you so much


    2. Thank you so much Captain. You responded so quickly. Unbelievable. Last time you had suggested some remedies for weak teeth and gums, I followed and it has helped immensely. I trust your blogs and advice more than any other knowledge resource on internet.

  67. We ask the indian govt to throw all "ANJEM CHOUDARYs " of india into jail.

    Anjem Choudary is a pakistani ( salafi/ wahabi ) who is now getting screwed by the englishman

    For 20 years Anjem Choudary stood on street corners, in shopping precincts, outside mosques, embassies and police stations and used his megaphone to drive a wedge between Muslims and the rest of Britain.

    Like India's rabid Salafi preacher Zakri Nail, Anjem Choudary's mindset is really simple. There are two worlds - the world of belief, meaning Muslims, and the world of disbelief, everyone else.

    Like Zakri Naik Anjem Choudary proclaimed a single Islamic state, under Sharia, for the whole world, for all areas of life.

    Rosthchild run BBC always gave Anjem Choudary a platform for his views.

    WHY ?


    Abu Rumaysah ( Siddharta Dhar ) worked as an aide to Anjem Choudary. Like Zakir Naik Dhar declared " I am Muslim first, second and last"

    Siddhartha Dhar, is called the “New Jihadi John”. Dhar, had skipped police bail in the United Kingdom to travel to Syria with his wife and young children in 2014.

    Hullo- STUPID John Bulls -- why dont you find out how Dhar, a marked man , found it so easy to travel to Syria.


    How many of you heard of crypto Jew Ganga Dhar ( Ghiyazuddin Ghazi ) ?



    THREE TRIPLES ( 100 /200 / 4 X 100 METRES ) --

    Nine golds for Usain Bolt , in a sport where just one GOLD MEDAL is a great lifetime achievement.

    Bolt surged down the track anchoring the race , like he has done so many times before, powering his way into sporting history — and further into greatness nay immortality

    YIKES !

  69. Dear Sir,

    Is it good to have a tablespoon of organic apple cider vinegar in 8oz of water first thing in the morning?








    She is a three-time World Champion, the current world record holder in the event ( 5.06 metres ) , who is THE greatest female pole-vaulter of all time

    She became the first woman to clear the five-metre barrier in 2005.

    this great heroine was punished by the zionist jew lobby because she told on TV that she favours a law banning "homosexual propaganda" in Russia.

    Isinbayeva had made her remark in response to several western athletes who pasted false finger nails showing the gay rainbow-- in support for gays and lesbians in Russia .




    capt ajit vadakayil




    capt ajit vadakayil

  72. pv sindhu is raking in the moolah as rich rewards for her silver medal.



  73. Captain, Nityananda talks about Sastanga yoga (shaktis or oneness) and they have better architecture than Patanjali siddhis. Can you please put a post on them .. from 42nd minute

  74. Hello Sir, Have you seen this news?


    Modi invites Prachanda to visit India

    Mr. Modi conveyed this to Bimalendra Nidhi, Deputy Prime Minister and Minister of Home Affairs of Nepal, when he called on him in the Capital on Saturday.

    Prime Minister Narendra Modi on Saturday extended an invitation to new Prime Minister of Nepal Pushpa Kamal Dahal ‘Prachanda’ to visit India at the earliest while expressing commitment to strengthening traditional bonds of friendship and kinship.

    Mr. Modi conveyed this to Bimalendra Nidhi, Deputy Prime Minister and Minister of Home Affairs of Nepal, when he called on him here.

    During the meeting, Mr. Modi conveyed his greetings and best wishes to the new government of Nepal led by Prachanda and extended an invitation to him to visit India at his earliest convenience, a PMO statement said.

    Mr. Nidhi briefed the Prime Minister about developments in Nepal where the new government took over recently.

    Mr. Modi said the relations between India and Nepal were not merely between the two governments but between the people of the two countries and that India is committed to strengthening these traditional bonds of friendship and kinship with the people of Nepal.

    The Prime Minister also said that India is fully committed to support the government and the people of Nepal in the post-earthquake reconstruction efforts.

    Relations between India and Nepal went through a bad phase last year and the two countries are hoping to make a new beginning after the new government took over in Kathmandu.


  75. Namaskar captain Ajitji....
    Recently a christian asked me .......homosexuality is accepted in vedic scriptures......there are cross dressers too......what to answer them..

























    Mustafa Kemal Atatürk was a JEW ( mind you, he is justice markendey katju's hero )

    read all 5 parts of the post below--

    if india has to be a superpower we must know world intrigue.

  79. Respected sir, i thank you again for enlightening us all with the correct understanding of sanatan dharma and so many more topics.
    A question about naga sadhus and other sadhus who take sanyas in youth and breaking bonds of family and avoiding marriage. You have said marriage is mandatory and all historic sages were married and only an exceptional pledge allows you to skip marriage. Then sir are all these naga and other sadhus (who roam about across jungles and villages ) misguided? Please forgive if i misunderstood something.







  80. peeyush baj
    August 23, 2016 at 3:15 AM

    dear captain.. namaste.

    Sir how do you so confidently say that we will be number 1 superpower in 17 years.. whats the rationale??/ plz elaborate.. you havent written a blog post on this.. on India's potential to be a world leader?


    Capt. Ajit Vadakayil
    August 23, 2016 at 6:21 AM

    ###########.. SUBJECT --- ROARING LION OR ONE EYED CAT . . ###########

    The Economy of India is the THIRD largest economy in the world measured by nominal GDP and the third-largest by purchasing power parity (PPP).

    We know what the G7 nations are worth . .

    India's economy is the world's fastest growing major economy…

    In another 17 years India will be planets no 1 superpower . .

    India is home to world's third largest Billionaires pool with 111 billionaires in 2016 and also the largest number of ultra-high-net-worth households that have more than 100 million dollars…








    Chinas borrowings hit 30.1 trillion USD at the end of last year, equivalent to 291 % of the chinese economys GDP. In the non-financial corporate sector, the debt-to-GDP ratio is estimated at 161 %.. ..all the G7 nations are beggar nations, whose debts can NEVER EVER be repaid without WW3 . ..

    China’s GDP growth is just 4.3% and NOT their official figure of 6.8%.
    Instead of tackling a debt pile estimated at 2.5 times the economy’s size, policy makers are only making it worse with a renewed credit binge.

    China continued to ignore their pathetic problem of BUBBLES WITHIN BUBBLES that drives the misallocation economy in China, or keep injecting massive credit flows into an already overblown economy in an attempt to delay the inevitable collapse.

    Chinese economy is being managed by MAD men who are keen to avoid loss of face . China’s ruling Community Party faces a dilemma between the urgent need to transform the country’s slowing economy, and the possibility of losing control and social unrest if massive layoffs happen.

    Japan’s level of government debt: the ratio of gross debt to GDP is 252% .. .

    Capt ajit vadakayil

  81. Veena N
    August 23, 2016 at 9:51 AM

    Dearest Captain
    In Kerala we dont celebrate Raksha Bandhan.
    But now the Rss is bringing the ritual of tieing Rakhee. Kindly do explain captain.

    Dr. Veena J.Nair



    Capt. Ajit Vadakayil
    August 23, 2016 at 1:02 PM
    hi vn,


    after king bali was shoved off to patala by vishnu -- vishnu developed remorse and went to patala where he stayed as a guest of bali

    vishnu wife lakshmi disguised herself as a brahmin woman and tied a sacred thread around king bali, declaring him as her brother --

    bali asked her what her wish is--and then he coaxed vishnu to go back to vaikunta

    The event initiated the custom of sister’s trying Rakhi on the day of Shravana Purnima.

    2300 years ago alexander the great took an indian wife roxanna , to know the secrets of the hindu kush pass.

    the greek army was routed by king porus. the elephants and the tibetan mastiff dogs psyched the greek horses. the greek army saw indian sages in deep meditation covered by cobras and they were afraid.

    when alexander was mortally wounded roxanna ran to porus and tied a rakhi around his wrist and made him her brother.

    capt ajit vadakayil








  83. Capt., What was the time of the day Lord Krishna was born? Couldn't find it. Some say he was born at midnight?

  84. sir went to visit your elder son ?

  85. Hi Captain.
    Please pen down an article on Tamil Bhramins ( dont mix Iyers and Iyengars ) . Write about Tambrahms right from the time of Sage Agastya.

    There are many accusations made by you against them like for eg Sucking up to the British to make Tamil the oldest language.

    But you should know that Iyers both Shivite and Srauta-Smartha subsects follow the Sanskrit scriptures.

    It is the Iyengars ( Thenkalai make 80℅ of Iyengars who are non Bhramin stock genetically ) who revere the Tamil Divya prabdhanam.
    So it is possible that it was their handy work to date Tamil as the oldest language.

    It is unimaginable that you always mention the bad about this community and not the good. And also put blame of the bad work done by the Tamil Iyengars on the Tamil Iyers.

    I am sure you know many Vadama iyers live in Kerala who came from Thirunalveli and Tanjavur.
    Uddana Shastri is also believed to be a Vadama Iyer who won the Revathi pattadhanam at your hometown Calicut.

    Also I would like to point out after reading your post on "Namboodiris the worst racist on the planet".

    That they are not the only Bhramins to have a left frontal lopsided min kudumi.
    Chidambaram Dikshitar sub group of Shivite Tamil Bhramin also sport the same hairstyle. But I have seen that you have mentioned that Namboodiris are the only Bhramin group in this planet to do so.

    The Sholiyar Iyer ( a sub group of Smartha Iyers ) also have a mun kudumi. The sholiyars Iyers too believe that Chanakya was one of Them.
    Many stauch Iyers have a seal of their caste mark on their right shoulder. Like a farmer marks his cows using hot iron.

    Please write a post on Tamil bhramins. I know you hate them but you have downplayed many of their contributons . You only talk about them post 1850 CE. Only 10 ℅ of them were British govt servants the rest had aversion to the British. And that 10℅ had taken 70℅ of British jobs.
    And these were the same Bhramin who revolted against the British in 1857 in Madras .

    I have heard from many malayalees that the Namboodiris were initially thiyyas or other lower caste , but later got initiated to Bhraminhood as there were no Bhramins in Kerala when Lord Parasuram came to Kerala.
    As there were no Bhramins willing to come to Kerala as Lord Parashuram had the sin on him . To remove his sin he wanted to gift land to Bhramins. So as no bhramins in neighboring Tamil country were willing to go to the newly created land, the locals were initiated into Bhramin hood and taught the Tantram form of worship.

    Most importantly write separately about Iyengars and the Thenkalai group particularly.

    I went through this site of the Srivaishnavam.
    It openly bashes Adi Shankara and looks down upon Afvaitins.

    It says that only followers of Srivaishnavam sampardaya get moksham.

    Hoping for a long reply and then a longer blog. UNbiased which doesn't start in 1800s and British jobs.

  86. WARNING:

















    punch into WORST JOURNALIST mr arnab goswami-- what do you see?

    my post about anti-hindu anti-watan NON-FADING VIOLET is no 1 among 35 million posts .

    i will give YOU the most dubious honor ever -- the worst legacy ever for a journalist --just ignore this warning and you shall see ---.



    capt ajit vadakayil









































    capt ajit vadakayil

    1. Hi Captain.
      Please pen down an article on Tamil Bhramins ( dont mix Iyers and Iyengars ) . Write about Tambrahms right from the time of Sage Agastya.

      There are many accusations made by you against them like for eg Sucking up to the British to make Tamil the oldest language.

      But you should know that Iyers both Shivite and Srauta-Smartha subsects follow the Sanskrit scriptures.

      It is the Iyengars ( Thenkalai make 80℅ of Iyengars who are non Bhramin stock genetically ) who revere the Tamil Divya prabdhanam.
      So it is possible that it was their handy work to date Tamil as the oldest language.

      It is unimaginable that you always mention the bad about this community and not the good. And also put blame of the bad work done by the Tamil Iyengars on the Tamil Iyers.

      I am sure you know many Vadama iyers live in Kerala who came from Thirunalveli and Tanjavur.
      Uddana Shastri is also believed to be a Vadama Iyer who won the Revathi pattadhanam at your hometown Calicut.

      Also I would like to point out after reading your post on "Namboodiris the worst racist on the planet".

      That they are not the only Bhramins to have a left frontal lopsided min kudumi.
      Chidambaram Dikshitar sub group of Shivite Tamil Bhramin also sport the same hairstyle. But I have seen that you have mentioned that Namboodiris are the only Bhramin group in this planet to do so.

      The Sholiyar Iyer ( a sub group of Smartha Iyers ) also have a mun kudumi. The sholiyars Iyers too believe that Chanakya was one of Them.
      Many stauch Iyers have a seal of their caste mark on their right shoulder. Like a farmer marks his cows using hot iron.

      Please write a post on Tamil bhramins. I know you hate them but you have downplayed many of their contributons . You only talk about them post 1850 CE. Only 10 ℅ of them were British govt servants the rest had aversion to the British. And that 10℅ had taken 70℅ of British jobs.
      And these were the same Bhramin who revolted against the British in 1857 in Madras .

      I have heard from many malayalees that the Namboodiris were initially thiyyas or other lower caste , but later got initiated to Bhraminhood as there were no Bhramins in Kerala when Lord Parasuram came to Kerala.
      As there were no Bhramins willing to come to Kerala as Lord Parashuram had the sin on him . To remove his sin he wanted to gift land to Bhramins. So as no bhramins in neighboring Tamil country were willing to go to the newly created land, the locals were initiated into Bhramin hood and taught the Tantram form of worship.

      Most importantly write separately about Iyengars and the Thenkalai group particularly.

      You have told that Thenkalai sect is R creation and Parkala mutt is too.
      Pls write more about this.
      Also you had stated once that Ranganatha swamy temple in Srirangam follows Kanva Yajur Veda which is poison injected by R.

      I went through this site of the Srivaishnavam.
      It openly bashes Adi Shankara and looks down upon Advaitins.

      It says that only followers of Srivaishnavam sampardaya get moksham.

      Hoping for a long reply and then a longer blog. UNbiased which Advaitinstart in 1800s and British jobs.

  88. Dear Sir,

    Big THANKS to you.

    What is Enlightenment ?

    How to attain it ?

    How can we identify (original) enlightened gurus in today's world ?



    i have exposed her by only 15%




  90. Maxmad
    September 2, 2016 at 6:02 PM

    Captain,before mongols invaded who was the ruler in Tibet ?


    Capt. Ajit Vadakayil
    September 2, 2016 at 6:34 PM








    Emperor Rishabha ( Adinath ) , the father of Chakravatri Bharata is the founder of Jainism in 8190 BC, and is the first Thirthankara.


    capt ajit vadakayil

  91. he Benami media have got instructions from their foreign masters to praise Mother Teresa , as she will be made a saint tomorrow . .

    Even PM Modi will jump into the bandwagon .. .

    Karo bhaiyya , make this evil woman a god , who cares ? ..


    This religion has destroyed mankind and killed maximum people . .


    Know the truth how Christianity was spread on this planet . .

    capt ajit vadakayil








    capt ajit vadakayil


  93. Capt. Ajit VadakayilSeptember 5, 2016 at 11:06 PM
    September 5, 2016 at 10:13 PM

    Keith Vaz British MP and friends of some very famous anal sex promoting Indians caught with his pants down with male prostitutes.....LOL......


    Capt. Ajit Vadakayil
    September 5, 2016 at 11:03 PM




    Almost all male homosexuals in the West use nitrite inhalants (amyl nitrites, called "poppers"). On chemical tankers we have it , for use when we load isocyanates like TDI , MDI , PAPI etc.

    It comes in small glass ampoules that were crushed to release their vapors, and received the name "poppers" as a result of the popping sound made by crushing the ampoule.

    When there is a problem we crush Amyl Nitrite capsules 5 times at 15 second intervals and hold under nose of victim.

    Amyl nitrite is a vasodilator with the formula C5H11ONO.

    The homosexuals use it as an inhalant, to expands blood vessels, increase heart rate for the euphoric state , relax the involuntary muscles -basically the anal sphincter.

    The effects set in within a few seconds. There is NO time for foreplay in dirty toilets or dark corners in parks. They are more orgasmic oriented, as opposed to pleasuring someone.

    Before Amyl Nitrate came on the scene( to prevent painful anal fissures and ulcers ) in the gay community there was no AIDS.

    In the 1991 film The Doors, Jim Morrison, played by Val Kilmer, sniffs Amyl Nitrite from a glass ampule in an elevator immediately before gay sex. Morrison died at age 27.

    Inhaled nitrites interact freely with endogenous trivalent nitrogen compounds to produce carcinogenic nitrosamines. Virtually all the early homosexual patients later diagnosed with AIDS had used poppers. Nitrites act on blood vessels, the site of KS, AIDS-related KS [Kaposi’s Sarcoma] and are known to be mutagenic. Poppers are immunosuppressive.

    AIDS-related KS [Kaposi’s Sarcoma] lesions occur most often on the chest and face, especially the nose; those are the body areas most heavily exposed to nitrite vapors. Persistent anal-rectal sexual activity can lead to various pre-cancerous lesions such as Bowen’s disease and Kaposi’s sarcoma.

    Whenever tissues are traumatized, cracked, or abraded, they are vulnerable to bacterial infection, especially when shit is just around the corner.



    capt ajit vadakayil














    RESULT ?




























    capt ajit vadakayil


      WELL --




      ATMA VICHARA . .








      capt ajit vadakayil










    OH YEAH ?


    HERE IS MINE -- 50.1 LAKHS












    capt ajit vadakayil














    capt ajit vadakayil









    capt ajit vadakayil


  99. தென்னவன்

    September 10, 2016 at 4:47 PM

    RSS is now calling Onam as VAAMANA JAYANTHI

    Capt. Ajit Vadakayil
    September 10, 2016 at 6:08 PM

    hi t,


















    capt ajit vadakayil

  100. Karvjyot
    September 12, 2016 at 10:42 PM

    Who was Adi Buddha ?


    Capt. Ajit Vadakayil
    September 12, 2016 at 11:05 PM

    hi k,

    The Gautama Buddha propagated by Jew Rothschild’s historians is a NOT the real Buddha.

    The first Buddha was Adi Buddha who lived in 1900 BC of Ikshvaku lineage whose preceptor was a Maharishis Vashista. Buddha can never be the ninth Vishnu avatar .

    He was born a century AFTER Adi Shankaracharya died.

    He was a contemporary of Mahavira the 24th Tirthankara.

    The first Thirthankara was Emperor Rishabha 8190 BC ( Adinath ) , the father of Chakravatri Bharata . India is named after BHARATA .

    BHARATA the son of the FAKE AND BACKDATED creation of Jew Rothschild , son of Shakuntala is FAKE.

    Dr. S. Radhakrishnan, ex-president has written, "Jain tradition ascribes the origin of the system to Rishabhadeva, the first Tirthankara. The Yajurveda and Bhagawata Purana mentions the name of Rishabha "

    Emperor Asokha never existed. He was a FAKE and backdated creation of Jew Rothschild.

    Capt ajit vadakayil


    1. Ishan Sharma
      September 12, 2016 at 11:57 PM

      Respected Captain
      But in this blog you have written that Mahavira, the 24th Tirthankara, was born in 4500 BC. Then how is it possible that he was a contemporary of Adi Buddha? Is it a typo or is it some new revelation?

      Capt. Ajit Vadakayil
      September 13, 2016 at 1:01 AM


      BUDDHA 1900 BC

      MAHAVIRA 4500 BC









    capt ajit vadakayil

  102. Gama Pada
    September 16, 2016 at 3:48 PM

    Hi Ajit

    Well well interesting Noam's article here -->

    Capt. Ajit Vadakayil
    September 16, 2016 at 7:15 PM

    hi gp,

    French THIEF Rene Descartes is known as the father of western philosophy, and Analytical Geometry


    The shipping company was called Verenigde Oost-Indische Compagnie or VOC..

    Before Jew Rothschild JEWESS Gracia Mendes Nasi was trading in spices with the Calicut King.

    Today the Israeli mint has produced a commemorative medal in Gracia baby’s name.


    THIEF Isaac Newton and THEIF Gottfried Leibniz, had access to Calculus THIEF Descartes stole from the Kerala School of Math.

    His work Descartes on REFLECTION and REFRACTION was stolen from India.


    The Jews always had a secret NASI ( nazi ) leader –till Israel was carved out.

    Bar Kokhba was a NASI

    Rabbi Yehudah Ha NASI was the editor of the Mishnah in its final form.

    Rabban Gamaliel II was a NASI --the first person to lead the Sanhedrin as Nasi after the fall of the second temple, which occurred in 70 AD. Onkelos performed the mourning ritual for Rabban Gamaliel II as though he were a king

    David Ben Zemah was a NASI
    Malkhi ben Sar Shalom was a NASI
    Daniel b. Azariah was a NASI
    Daniel and Jedidiah b. Zakkai were NASI
    Shem Tov was a NASI
    Gracia Mendes NASI was one.
    Dom Joseph NASI was one ( nephew of Dona Gracia Mendes NASI) A Court Jew, he was appointed the Lord of Tiberias
    Roth- the house of NASI we all know.
    Hilter was a NAZI ( nasi ).



    In 1512, the House of Mendes, had TOTAL monopoly of the pepper trade exported by the Calicut king ( my hometown ) recently encountered India, enabled it to open a branch office in Antwerp.

    In 1498 Vasco Da Gama had landed in my hometown Calicut " discovering " India.

    Crypto Jewess widow Dona Gracia Mendes, ( Senyora Beatrice de La Luna Nassi),was a great heroine for the crypto Jews Marranos,


    Capt ajit vadakayil




    one of the reasons why capt ajit vadakayil is a living legend at sea, is because i offered myself as a SACRIFICIAL GOAT just to get my kicks and play games with my detractors

    i would offer to change cargo grades which had never been tried before at sea.

    for example-- i would offer to change grade from viscous lub oils to potable ethanol or methanol fibre grade in brazil/ argentina and that too without going out to sea for open tankcleaning after unloading luboil .

    yank charteres wanted to send yank , danish and norwegian obeservers ( super cargoes ) and i would say NO PERMISSION --


    i make too many enemies ho are miffed with my cockiness-- if i fail i am disgraced forever and will be sacked. even the company may shut down due to losses . .

    my detractors would wait with bated breath for me to fall PHUTTTTT on mE face.

    but i would always win . .











    i want all my readers to read above TWO posts--







    capt ajit vadakayil












    capt ajit vadakayil

  105. Somebody asked me about burial of Jivan Mukhts being BURIED .





    Muniyaras are dolmens ( burial chambers ) made of four stones placed on edge and covered by a fifth stone called the cap stone

    When the white invader came to India we had more than 5000 muniyaras in Kerala alone – all of them on mountain tops of Western Ghats. Today there are just 400 muniyaras in Kerala—ones which were NOT noticed by the white invader.;geo=303881&detail=1371324

    The white BASTARDS took away these huge slabs of granite by breaking them into pieces. This was an EXTREME form of cultural terrorism, because Europe , Russia , Korea, and the world over were full of Dolmens—of Druids ( ancient Hindu sages )

    Before 7000 BC, india ruled the whole world ,and there was only ONE religion


    capt ajit vadakayil



    Dronacharya taking away Ekalavya’s thumb to make Arjuna the best archer , and because he is low caste is POISON INJECTED by the white christian invader to alienate dalits for divide and rule.

    Dronacharya asked for his right thumb as Gurudakshina.

    Much later in life the Pandavas with Drona had a second meeting with Ekalavya.

    This was after Yudhishtar did the Rajasuyayoga, five Pandavaas visited Hastinapur and Dronacharya suggested that they go for hunting to same forest.

    Same situation, same dog, and Ekalavya pasted the dog before Arjuna could react -- once more.

    At that time Drona explained about the thumb.

    By asking for guru dakshina I accepted Ekalavya, as my student.

    By chopping off his thumb and offering it as guru dakshina, Ekalavya showed he was noble despite his low caste.

    Drona explained that knew he was a left hander.

    He held the bow with his right hand. His arrow-bush was attached to his left shoulder. His short sword with its holder was hanging on his right side.

    Arjuna apologized to Ekalavya for his jealousy- and they hugged ..


    let hindus continue worshipping a fake radha and let the dalits continue believing that manu wanted to pour molten lead in their ears if they listen to vedas.



    capt ajit vadakayil


  107. shailesh M
    September 22, 2016 at 4:22 AM

    The main problem of rajiv dixits followers is that they know they are in a war, but they dont really know whom they are supposed to be fighting with, they cannot pinpoint their real enemy. And I am interested to know wether rajiv dixit himself didnt knew about the zionist hand in indian affairs and how they work or did he purpoself kept quiet. If he purposely kept quiet then it tells something about him, and for me it is difficult to imagine that he didnt knew about these people.

    Also why was he murdered? Who did it ? was it by baba ramdev ? r someone else? and why?

    People say that he was murdered because he was awakening the masses..but was he really awakening the people by not uttering the R word? All these are not so explain.


    Capt. Ajit Vadakayil
    September 22, 2016 at 10:08 AM















    today you google ROTHSCHILD why does 21 million posts jump out ?

    when rajiv dixit told the entire ramayana --without mentioning ravan --what is his bullshit PARAYAN worth ?

    does rajiv dixit have a technical brain ? yes , he is a great patriot . .

    why does our BENAMI MEDIA keep away from the word R like it is the plague?



    capt ajit vadakayil









    MAO WAS A JEW . .














    capt ajit vadakayil















  111. I have a confession to make

    One of my readers asked me if I heard Modi’s speech at Calicut, and I said YES.

    The truth is that I listened to Venkaih Naidu’s speech. After 10 minutes of hearing Modi’s speech ,I fell into deep REM sleep with the TV’s heavy SONY speakers booming loud.

    After that I went to the gym with my younger son, had beer and dinner and then listened to Modi’s recorded speech.

    My wife said , I snored during my sleep !










    The whole of India is still in a state of shock as to how JNU has emerged stronger as a commie base –with Collegium Judiciary backing these anti-watan , anti-hindu commie students and professors.









    Capt ajit vadakayil

  112. The Scriptwriter
    September 25, 2016 at 5:04 PM

    Dear Capt,
    Consider it done.
    For 800 years We Indians didn't have the right leaders. But we have now and his name is Capt Ajit Vadakayil. The young generation looks up to you and the wisdom you share!
    Jai Hind!

    Capt. Ajit Vadakayil
    September 25, 2016 at 8:21 PM
















    capt ajit vadakayil

  113. Hello Captain,
    What do you think if vatican might have stored some of our Indian archives?
    And they don't want to return the archives, as we can do the genesis & research and will lead the world.

  114. Atish Awasthi
    September 27, 2016 at 6:30 PM

    would you please throw some light on kainchi dham temple is it real or fake please if you have any information about it.i shall be thankfull to you.


    Capt. Ajit Vadakayil
    September 27, 2016 at 7:09 PM

    hi aa,






    Naive devotees stayed for 100 days at the ashram --because Neem baby assured that any person who chants the Hanuman Chalisa 100 times daily for 100 days will get MOKSHA. ( verse 38 ).


    hindus stopped reciting SANSKRIT MANTRAS and switched over to AWADHI mantras.





    Gora singer Krishna Das spAke : “It goes far beyond Hindu mythology. To chant the ‘Chalisa’ is to acknowledge that we are suffering"

    Many gora devotees after having drugs claim that they say neem baby morph into a monkey--and all were mahaa impressed. Drug dealers made hay ..

    Every drugged gora devotee would be given a YELLOW BOOK of hauman chalisa with a monkey on the cover

    The propaganda was Tulsidas was also an avatar of Hanuman

    Here is Krishna DAS baby-- giving BULL

    capt ajit vadakayil


  115. sai
    September 28, 2016 at 10:36 AM
    you told about healing properties of Gaga long ago and now scientists are agreeing

    Thank you

    Capt. Ajit Vadakayil
    September 28, 2016 at 10:43 AM



    REASON ?


    capt ajit vadakayil

  116. This comment has been removed by the author.


    "Salman Khan says Pakistani actors are artists, not terrorists"




























    capt ajit vadakayil

  118. the WAHABBI/ SALAFI brainwash is - - -








    The number 72 applied to a good man deserving heaven.

    Like in Hinduism a Jivan Mukt ( who was buried and NOT cremated ) had a perfectly balanced BODY/ MIND / SPIRIT .

    This was possible by PRANA flowing free and pure through his 72 MAJOR nadis.

    "Through one of these, the Udâna leads us upward by virtue of good deeds to the good worlds, by sin to the sinful worlds, by both to the worlds of men indeed." (Prasna Upanishad Q3)- 5000 BC

    The TOP THREE being Shushumna , Ida and Pingala.

    I shall mention a few important nadis- Gandhari, Hastajihva, Kuhu, Saraswati, Pusha, Sankhini, Payasvini, Varuni, Alambusha, Vishvodhara, Yasasvin etc

    All of these 72,000 nadis do NOT have a physical manifestation--as they are meridian paths for energy..

    "A hundred and one are the arteries of the heart, one of them pierces the crown of the head. Going upward through that, one becomes immortal at death. Other arteries, going in different directions, only serve as channels for his departure from the body, ..." (Chandogya Upanishad -CU 8.6.6) 5000 BC

    These Nadis ( metaphysical meridians ) are kept primed by deep diaphragmatic breathing and by following the laws of the Universe.

    Surah Al-Waqia (56:35-37) of the Quran describes the houris as "most refined", created by Allah "in the best of form" and well-matched". This has NOTHING to do with deviant sex.

    Let me quote some POISON INJECTED ( by Jews ) Hadiths.

    The Jews have injected so much poison into Hinduism that this is just 0.001%.

    "The believer will be given such and such strength in Paradise for sexual intercourse".

    "The penis of the Elected never softens" and that men in heaven will have the sexual strength of 100 men"

    “Appetizing vaginas- non-menstruating / non-urinating/ non-defecating/ untouched / with hymen unbroken by sexual intercourse”

    “ Every male admitted into Paradise will be given eternal erections and wed to 72 wives, all with libidinous sex organs”

    “ Full breasted / large, round breasts which are not inclined to hang".

    “ Would not urinate, defecate, become pregnant or menstruate. Hairless except the eyebrows and the head"

    “ Round about the believers will serve, to them, young boys, who will be as pearls well-guarded. They will be served by immortal eternal young boys ... as fair as virgin pearls “ ( FOR ANAL SEX )

    “The marrow of the bones of their legs will be seen through the bones and the flesh."

    Jews have compared HOURI to WHORE.

    The number 72 comes only in the Hadith -- which has been poison injected by Jews --out of shape.

    72 number is NOT there is the ORIGINAL FIRST WRITTEN Koran at Cheraman Perumal mosque by Namboodiri convert Malik Deenar and party.



    even hafeez saeed has his ZEBIBA mark in the wrong place . . . .

    capt ajit vadakayil

  119. Rahul menon
    October 18, 2016 at 10:44 AM
    Hello Sir,

    I came across an article The ‘Center of the universe’ located in Tulsa has an incredible acoustic anomaly that seems to defy the laws of physics..

    What can be the real reason to this?

    Capt. Ajit Vadakayil
    October 18, 2016 at 11:19 AM

    hi rm,


























    capt ajit vadakayil

  120. Rn Murthy
    October 18, 2016 at 2:30 PM

    Dear Capt Ajit sir,

    What's the qualities of Brahmarishis ? Who can judge and declare them after a test or something ? Recently Mohanji Namboothiri was conferred the Brahmarishi title by Avadhutha Nadanandaji in Kurnool as below...;oPdaqZUSVxHygXiKilH4ugrR0HatB2xK9ibor0sbFSpTkk1gUDhBjUcnwZ6SoKk5ABVW4yFX0QsgCaq~_EhO7JY6kRVMPgEUP7MOCADn6lawBfhe0KwcIZ3GUGEsCbRlsp8wZ3rSZAMJDGQ5F04RHvOESd~_FtW0dh16MTlwueoWdB6~_1025dUFj22AnAfOcOZMseZ~;~_si95TdGL9~;ihaZQ0klAYZzDoeni~;t0508num8hmGn9bv0ARNcHGmBdgHdY7x32fHKqXgVe23~_vrSqzQve7whbHXYTR3QGMHrN1T5Ykoiej5yzIownmYeTlKP1Ma3H802E82KUCilcyw1Vx~;OoxFbadP7X9NrZgajRtgYLBsCB~;wfY8zDn~;D5yfnrZuBMhxX~;uAhOLmUEUJ26qNqS2aWk2OoMLhwVnUMcvr4j3A5R~;2cvql.bps.a.1192078487516553.1073742005.131411020249977/1192080260849709/?type=3&theater
    What is the main purpose and duties/work of Maharshis ?

    Capt. Ajit Vadakayil
    October 18, 2016 at 3:20 PM



    Mohanji baby started receiving guidance from Shirdi Sai Baba, Mahavatar Babaji, Sathya Sai Baba, Agastya rishi - AIYOOOOOOOOOOOOOOOO !



    QUOTE : In February 2007, Mohanji was at an ashram in Kerala, when he was overcome by an unexplained sickness and nausea. So the swami of the ashram took him outdoors for a walk in the fresh air. They walked up to a house, about 500 yards away, went inside, and just as Mohanji sat on a chair, he lost his physical consciousness, slipping into deep samadhi. Sacred ash (vibhuti) started pouring out through the top of his head, slowly falling down his body. In the Dattatreya tradition, they say that sacred ash gushing out of the sahasraara (the head chakra), is a sign that the last remnants of karmas are being exhausted. Along with the vibhuti, he became incandescent, a bright light glowing from within him, radiating through his body and clothes. His body seemed transparent, his eyelids turned golden and his consciousness expanded beyond description. He felt everything was within him. UNQUOTE










    capt ajit vadakayil









    capt ajit vadakayil











    the above is one of the SUCCESS STORIES of this blogsite



    capt ajit vadakayil




    It was a sheer copy of the British model, just amended to suit India-- a draft given to Ambedkar on the quiet by JEW Rothschild.. There was NIL brainwork involved.

    Why don't you compare the two constitutions. Where is the intelligence, in copying and plagiarism?

    Dr B. R. Ambedkar was just the Chairman of an eminent team consisting of K M Munshi, Alladi Krishnaswamy Iyer, N Gopalaswami Ayengar , Madhava Rao , Md. Saadullah , TT Krishnamachari and a constitutional advisor Sir Benegal Narsing Rau .

    The separation of powers among the major branches of government, the establishment of a supreme court was copied from the US model, provided by Rothschild.


    like THIYYAS ( ruling class for millenniums ) of kerala MAHARS were demoted by Jew Rothschild-- using BR Ambedkar's grandfather





    capt ajit vadakayil

  124. Div
    November 28, 2016 at 10:43 AM


    Capt. Ajit Vadakayil
    November 28, 2016 at 10:55 AM








    capt ajit vadakayil

  125. raj
    December 2, 2016 at 5:05 PM


    Capt. Ajit Vadakayil
    December 2, 2016 at 6:26 PM









    capt ajit vadakayil
















    capt ajit vadakayil

  127. Sir

    It is still written "to be continued"


  128. Dharma Sansthapana
    December 16, 2016 at 9:42 PM
    that post is reproduced from by a chutney mary ,

    the founder & editor of is a goan catholic half mulatto b@$tard naresh fernandez who's bashing hindus from past 20 years ,

    goa and mumbai is full of such self loathing christians who leave no opportunity in criticizing hindus ,how easily they forgets the goan inquisition where their ancestors got raped and tortured by Portuguese leaving the illegitimate b@$tards , is making lot of noise , Rajiv Malhotra is fighting against these self loathing chutney mary pickle johns of ,we should help him .

    Capt. Ajit Vadakayil
    December 16, 2016 at 9:56 PM







    capt ajit vadakayil


  129. Dharma Sansthapana
    December 24, 2016 at 1:02 PM
    Namaste Captain

    was prabhupada a genuine guru ? or was it all pre planned, he traveling to west and spreading Krishna consciousness ?
    in his later days he made many comments on governments cheating people , he opposed paper currency fraud and recommended gold standard ,self-sufficient farm communities etc ,

    Capt. Ajit Vadakayil
    December 24, 2016 at 1:49 PM




    December 24, 2016 at 2:46 PM
    prabhupada is a R fake mutt product .... they claim lineage from chaitanya whose real name was vishwambar mishra who was a yogi adept in vaishnava sahajiya kundalini tantra which iskcon does not practice but substitutes with their mahamantra japa

    Capt. Ajit Vadakayil
    December 24, 2016 at 3:02 PM



    BALLS !



    Jew Rothschild inserted a POISON INJECTED chapter CHaitanya Upanishad --in the Atharvaveda

    Today Gaudiya Vaishnavas, revere Chaitanya baby as a Krishna with the mood and complexion of his source of inspiration Radha.

    FAKE Chaitanya Mahaprabhu kept singing the praises of Radha.

    capt ajit vadakayil


  130. Kumar S.
    December 25, 2016 at 8:34 PM

    Hello Ajit Sir..I am Sachin from Mumbai....asked you to throw some light on Bargotis and Afghans relationship with the opium Trade. Plz enlighten if you have anything on it...Thanks and regards


    Capt. Ajit Vadakayil
    December 25, 2016 at 9:03 PM
    hi ks,

    bargotis worked in ghazipur--at the biggest opim factory on this planet--belonging to Jew Rothschild --operated by his Indian front CRYPTO JEW marwari/ kathiawari agents.

    This place was full of CRYPTO JEW muslims -

    The first Scientific Society of India was established first in Ghazipur in 1862 by CRYPTO JEW Sir Syed Ahmed Khan for propagating modern Western knowledge of science, technology and industry

    Most of the Malwa Opium was processed in Ghazipur Opium den



    The Ghazipur opium factory is mentioned in the novel "Sea of Poppies" by Amitav Ghosh.

    The Ghazipur Opium factories are referred to as sources of illegal smuggling for opium manufacture in the movie "Udta Punjab" (2016).

    The Nimach opium factory has the largest opium VAT on this planet larger than a swimming pool --it could hold 500 tons of opium.

    Today Opium is dried and processed at these factoriesand is used for extraction of various products like Codeine phosphate, Thebaine, Morphine sulphate, Noscapine etc.

    Lot of this is exported to Islamic countries via Bangladesh

    The first organised MAFIA of India were CRYPTO JEW PATHANS in Mumbai created by Jew Rothschild. Today their descendants are in Bollywood.

    Mafia in Mumbai know CRYPTO JEW Pathan ( from Peshawar ) Ayub Khan Pathan alias Ayub Lala. He was the big boss of Pakhtun Jirga e Hind, an association of more than 14500 CRYPTO JEW afghani "muslims" settled in Bombay.

    JEW Ayub Lala controlled the Mumbai mafia-- whorehouses, gambling dens, Opium dens mostly owned by CRYPTO JEW Marwaris and Kathiawari Jains ( Gandhi's clan who are diamond dealers today ) and Parsi owned drug cartel including spurious liquor dens in Mumbai.

    Ayub Lala owned the KawaKhanas --a drink made from opium served with black tea) and Chandolkhanas --today known as hookah parlours. Today most of the CHAMIYA bar ( whore hosues ) started by Colegium Judicary belong to the CRYPTO JEW Muslims who have FAKE zebiba marks on their foreheads

    They invest their money in Bollywood and Bollywood stars dance for the Mumbai Police annually



    i am telling only 2%

    capt ajit vadakayil


  131. Takloo Haivan
    December 28, 2016 at 5:46 AM
    Dear Captain ..... Google now cannot hide holocaust denial websites


    Capt. Ajit Vadakayil
    December 28, 2016 at 7:46 AM



    ( i know their pashtun ancestral benjamin background ).

    SO ?













    TODAY ON 28TH DEC 2016 IT IS 118 LAKHS























    capt ajit vadakayil

  132. Capt. Ajit VadakayilDecember 28, 2016 at 11:49 PM

    no 2 ranked PM modi is 6.6 crores ahead of me ( rothschild owned)

    no 1 ranked BBC is 21.2 crores ahead of me ( rothschild APCO braned )


    my profile view is no 1.2 crores . there is NO blogger on this planet with more than 3 lakhs profile view.










    capt ajit vadakayil










    Couple of years ago, I say a TV channel blatantly talking about SAVITHA BHABHI DOT COM.

    The anchors of HEADLINES TODAY were praising bold and beautiful Savitha Bhabhi to the skies.

    How Indian women should take a leaf out of Savita Bhabhi's life and be independent and do what they please.

    Out of curiosity I check out this cartoon strip site and noticed that it was obscene and foul XXX stuff.

    How a married Sati Savitry Indian woman would fornicate every where and with everybody. Orgies all over the place.

    She would open her legs even for the vendors who sell stuff at the door step. Thrust was on her sindhoor, mangala sutra and sari

    The Indian Govt kept quiet till one day a small boy sent a Savitha Bhabhi clip to his teacher, via his mobile phone, on whom he has a crush. The teacher started crying and other teachers complained.

    And then there was a furore in the Parliament.

    Savitha Bhabhi dot com shut down and now they operate clandestinely as Kirtu dot com.


    SO SO SO















    bharatmaata kee jai !

    capt ajit vadakayil

  134. ramas parmar
    January 25, 2017 at 3:47 PM

    Sir is the soul electromagnetic in nature?..if not then what form of energy we can relate it to?.Does gravity have an pull on the soul?

    Capt. Ajit Vadakayil
    January 25, 2017 at 4:02 PM


    As the mobius knot's strands get close vibrations get higher and energy boosts --when vibrations are highest the soul is a MOKSHA soul ( same vibrations as 7th astral layer )



    this is the first time it is being revealed on this planet

    I am just revealing 1% - CHAATNE KEH VAASTE

    my revelations now jump to 27.5%

    capt ajit vadakayil

  135. Dharma Sansthapana
    February 4, 2017 at 1:17 PM

    Namasthe Captain

    can you please elaborate the concept of 'Saam Dhaam Dhand Bhed ' of Chanakya's Neethi


    Capt. Ajit Vadakayil
    February 4, 2017 at 2:01 PM


    Saam Daam Dand Bhed : Chanakya Neeti
    According to Chanakya, the primary duty of the king is to protect "Dharma"



    SAAM -knowledge ( negotiations, ask after explaining why, evince interest for help , convince , create sense of belonging , foster brotherhood , raise awareness from correct perspective )

    DAAM -money ( offer , pay , reward, catalyse, mollify , incentives )

    DAND - punishment ( create fear by display of power, consequences , sanctions, discipline , penalize )

    BHED – discriminate ( describing right from wrong –conscience appeal , catalyse , laying own terms )



    In Malayalam and Sanskrit BHED means “better option “

    DAND is as simple as not allowing your child to eat unless he has washed his hand .

    capt ajit vadakayil







    capt ajit vadakayil


  137. Muthu Swamynathan
    March 4, 2017 at 8:20 PM

    Respected Captain,

    This website tries to falsify you blog that "Jesus never exist". The content even mentions that "brown man's accusation that jesus never exists".


    Capt. Ajit Vadakayil
    March 4, 2017 at 8:30 PM





    capt ajit vadakayil

  138. Chrish Iangaar
    March 5, 2017 at 6:09 PM


    Capt. Ajit Vadakayil
    March 5, 2017 at 7:47 PM







    QUOTE: This blogsite will transform your mind . You yourself, are the teacher, the pupil, the messiah, the seeker, the traveller and the destination . It is no measure of health to be well adjusted to this profoundly sick society . I am from INDIA, the mother of all civilizations . I will be re-writing world history , and this will surely not gratify the evil hijackers of human history . Awaken your inner voice . Experience the joy of your own being . Your own conscience is the best interpreter . In a time of universal deceit, telling the truth is a revolutionary act . The naked truth can never be hate speech or defamation. This blogsite does not sacrifice truth on the altar of political correctness . You shall know the truth and the truth shall set you free . Dont ever underestimate the value of this blogsite .UNQUOTE

    capt ajit vadakayil


















    capt ajit vadakayil

















    The Gorakhnath Nath Mutt propagates the FAKE Nath sampradaya created by Jew Rothschild.

    The founder guru Matsyendranath is a FAKE and backdated creation of Jew Rothschild

    Jew Rothschild created the FAKE Kaula Tantra attributed to FAKE guru Matsyendranath.

    Jew Rothschild funded the Bollywood movie Maya Machhindra made by Chitpavan Jews

    KAMMA NT Rama Rao acted as Machhindra Nath

    Jew Rothschild used his front Shantaram company too make the movie Ayodhyecha Raja about the FAKE Raja Harishchandra- to show that India had a chandala caste system in ancient day

    Gandhi and crypto Jew Kerala Prince Raja Ravi Varma was used to propagate Rothschild's creation Harishchandra

    capt ajit vadakayil

  142. Soujanya V
    March 12, 2017 at 11:09 AM
    Hi Sir,

    Today I spoke with an elderly Mexican about something interesting , He told me that aztecs, mayans and Inca people know that god Quetzalcoatl came from India. I was shocked that they knew that he came from india. He told that he stayed there and was their teacher, he returned back to india after that. I showed pictures of underwater dwaraka and said that it was lord Krishna / Quetzalcoatl's city, there was amazement looking at the pics of dwaraka. It seems god Quetzalcoatl promised to visit them again, they are waiting for him to come and visit them.

    He told that the evil people who rule the world hid so much of the history.

    Thank you


    Capt. Ajit Vadakayil
    March 12, 2017 at 4:05 PM



  143. Muthu Swamynathan
    March 25, 2017 at 12:13 PM
    Dear Captain,

    POPE is trying to save Christianity from downfall. he hehe

    His words only reflected you, Captain.

    He wants christian youngsters to write their own history. he hehehe. Lies helped them for 1350 years and now they need new lies to continue their harvest for another 1350 years.





    THE CURRENT POPE FRANCIS IS A JESUIT JEW ( Jorge Mario Bergoglio from Argentina )

    JEW Mussolini and his Jewish gang escaped to Argentina along with JEW Hitler


    Archbishop Bergoglio was created a cardinal by Pope John Paul II with the title of cardinal-priest of San Roberto Bellarmino, a JESUIT church Bergoglio has close ties to the Jewish community of Argentina, and attended Rosh Hashanah

    Pope Francis himself said that he named himself after Francis of Assisi.

    John Bernardone Morosini ( Francis of Assisi ) was born in Paris to a rich Jewish banking family -- a family of Sephardic Jewish Venetian traders. His father was a banker JEW Peter Bernardone Moriconi

    The name "Francis" is a nickname anomic –just means born in France.

    The Morosini family stretched from England to Constantinople. The Mosrosini ships took in Kerala spices from Constantinople and sold it all over Europe.

    Dongaressa Morosina Morosini-Grimani was the daughter of Andrea Morosini, who married Marino Grimani in 1560. Shakespeare’s “Merchant of Venice” is inspired by this family—Shylock the JEW is from this play.

    They were UBER rich –I ask just visit the Morosini-Grimani castle constructed in 1485 AD north of Pula at Svetvincenat in current day Croatia. I have seen it

    MOROSINI, GIULIO (Samuel ben David Nahmias ) WAS A NASI- He was engaged in Jesuit activity.. In his book La Via della Fede (Rome, 1683) he wrote that Jesuit Jews do NOT follow the Ten Commandments.


    The Sanhedrin trial of Jesus Christ is a cooked up story –as Jesus never existed.








    Capt ajit vadakayil






  145. Rahul menon
    March 29, 2017 at 9:13 AM

    Finally someone actually depicted how pyramids were built as you had said...

    The video is very good by the way.

    Capt. Ajit Vadakayil
    March 29, 2017 at 10:18 AM

    hi rm,


















    capt ajit vadakayil


  146. Sangeetha
    May 11, 2017 at 9:09 PM

    Captain, Krishna addresses Arjun as Bhaarata. Is it because Arjun was descendant of Bharata , son of Rishabha ? Or was it a form of address like Arya ?

    May 11, 2017 at 9:37 PM

    Highest Gratitude to you Captain for explaining us name of our country......Bharat.

    Jai Hind

    Capt. Ajit Vadakayil
    May 11, 2017 at 10:20 PM





    Let me quote Wikipedia-
    QUOTE : He ruled virtuously and earned great fame and was known by the titles of "Chakravarti" (emperor) and "Sarvabhauma" (Sanskrit: सार्वभौमः). Bharata performed many sacrifices and Sage Kanva was the chief priest at those sacrifices. Bharata performed a hundred Horse sacrifices on the banks of the Yamuna, three hundred on the banks of Saraswati and four hundred on the banks of the Ganga. He again performed a thousand Horse sacrifices and a hundred Rajasuya. He also conducted sacrifices such as Agnishtoma, Atiratra, Uktha and Viswajit. He also performed many thousands of Vajapeyas.[7] :-UNQUOTE




    capt ajit vadakayil








    capt ajit vadakayil


  148. The mind of god represented by the divine 3D geometry of Sri Yantra, is cosmic music resonating through hyperspace. Sri Yantra represents OM of digital value 108. Sruti verses of Vedas is music of pure mathematics . It cannot be interpreted unless you can look behind the words.-- Capt Ajit Vadakayil

