Wednesday, August 17, 2016

SANATANA DHARMA , HINDUISM EXHUMED AND RESURRECTED, PART 65 - CAPT AJIT VADAKAYIL



THIS POST IS A CONTINUATION OF PART 64, BELOW - -





NONE OF THE SO CALLED ANCIENT CIVILIZATIONS OF THE PLANET HAVE LEFT BEHIND ANYTHING OF CEREBRAL VALUE IN WRITING--  ABSOLUTELY  NOTHING !!     

80% OF OUR VEDAS ( SAMHITAS/ BRAHMANAS/ ARANYAKAS/ UPANISHADS) HAVE BEEN STOLEN / DESTROYED BY THE WHITE INVADER.    

THE JEALOUS WHITE MAN  POST DATED OUR ANCIENT WORKS PENNED DOWN IN 5000 BC,   TO SUIT THEIR UNDERSTANDING OF BIG BANG DATED AT A RIDICULOUS 4004 BC.    

IN THIS INTERNET AGE, IT IS PAY BACK TIME !   


THE WORLD SHALL KNOW THE GLORY OF ANCIENT INDIA  !! 



CHECK OUT THE SOUND OF  PATANJALIs YOGA SUTRAS PENNED DOWN 7000 YEARS AGO, WHEN THE REST OF THE WORLD WERE RUNNING AROUND NAKED , DOING GRUNT GRUNT FOR LANGUAGE .



CHAPTER I-  SAMADHI PADA-   CONTEMPLATION
atha yoganushasanam
yogashchittavrittinirodhah
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pramannaviparyayavikalpanidrasmritayah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
vitarkavicharanandasmitaroopanugamatsanprajnatah
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tajjapastadarthabhavanam
tatah pratyakchetanadhigamopyantarayabhavashch
vyadhistyanasanshayapramadalasyaviratibhrantidarshanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah
duhkhadaurmanasyanggamejayatvashvasaprashvaavikshepasahabhuvah
tatpratishedhartham ekatattvabhyasah
maitreekarunamuditopekshanansukhaduhkhapunyapunyavishayananbhavanatashchittaprasadanam
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
ksheennavritterabhijatasyevmanergrahitrigrahannagrahyeshutatsthatadangjanatasamapattih
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih

CHAPTER II - SADHANA PADA-- PRACTISE

tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
anityashuchiduhkhanatmasunityashuchisukhatmakhyatiravidya
drigdarshanashaktyorekatmatevasmita
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
dhyanaheyastadvrittayah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
samadhisiddhirishvarapranidhanat
sthirasukham aasanam
prayatnashaithilyanantasamapattibhyam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah

CHAPTER III – VIBHOOTI PADA - MANIFESTATION

deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
sarvarthataikagratayoh
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
parinamatrayasanyamadatitanagatajnanam
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
sthoolasvaroopasookshmanvayarthavattvasamyamadbhootajayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti

CHAPTER IV--  KAIVALYA PADA --  LIBERATION

janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
nirmannachittanyasmitamatrat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
chiterapratisankramayastadakarapattausvabuddhisanvedanam
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah
purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti






4.24- - tadasankhyeyavasanachitram api pararthan sanhatyakaritvat


Though the framework of consciousness is interwoven with innumerable desires and subconscious impressions, it exists for the seer on account of its proximity to the seer as well as to the objective world.



Though consciousness has been fogged with impressions (samskaras) throughout eternity, its aim is not only to satisfy the desires of the senses (bhoga), but also to further the emancipation (apavarga) of the soul. Consciousness is tied by a hidden force both to the seer and to nature. It is well equipped to reach the seer, though it has no ambition of its own except to serve its Lord. Consciousness has innumerable inclinations and impressions derived from memory, among which longing for pleasures and freedom from pleasures stand out. They are desired impressions. From this, it becomes clear that consciousness, being close to nature and spirit, feels that it does not exist for its own sake but for the sake of purusa and prakrti.. Once consciousness is cultured through yogic discipline, it becomes matured and illumined. It realises that the seer is not interested in objects of pleasure and opts to serve with disengagement. Now that it comprehends its inner value, it realises the triviality of nature's pleasures and turns towards the path of Self-Realisation. Thus transformed, it begins its journey towards emancipation. If one's karmas are good, they awaken curiosity and guide it towards the path of kaivalya; they reward one's effort with the vision of the soul. Yogic practices speed up this process, beginning with the conquering of the body and ending in the vision of the soul.  This is salvation.  For most modern scientists (who have NO access to the wisdom of the Vedas ) mind appears to be the master, which receives numerous inputs through senses, synthesizes them and understands them. But, mind is not the master. It is just an efficient manager. It is always working for the Purusha, the pure consciousness. The master never appears in the forefront. But, the power of illumination belongs to the Master. The mind receives only a reflection of this power, to receive the numerous impressions of the world outside. One must understand the process very clearly and keep the mind as an efficient manager working for the self, which is the Purusha, the pure consciousness. The Purusha may be a mere witness, the ultimate seer. He may have the capability to illumine himself and illumine the mind, and through the mind, the external world. But, Purusha has to operate only through the mind, which has no self illumining capability, for which it depends on the Purusha. The bridge between the Purusha and the world is the mind. That mind field, though filled with countless impressions, exists for the benefit of another witnessing consciousness, as the mind field is operating only in combination with those impressions. However subtle we go in our exploration of the depths of the mind, that mind itself gets its life force from pure consciousness, like the electricity and the computer.   The computer cant perform without electricity. This pure consciousness is the Reality that we want to experience, unalloyed even by the subtlest aspect of mental process. While the computer operates for the external user, it is the other way around with consciousness. The mind field operates for the benefit of the consciousness. Though having countless desires, the mind-stuff exists for the sake of another [the Purusha] because it an act only in association with it. Though the fabric of consciousness is interwoven with innumerable desires and subconscious impressions, it exists for the seer on account of its proximity to the seer as well as to the objective world.  This is because the mind cannot function without the power of the Perceiver. The mind is a compound of various things, and therefore it cannot work for itself.  The proximity (samhatya) of the spirit is itself, the cause of the innumerable moods and urges.



4.25- - visheshadarshin aatmabhavabhavanavinivrittih


For one who realises the distinction between citta and atma, the sense of separation between the two disappears.



When the difference between consciousness (citta) and the projector of the consciousness (citi) is recognised, the search for Self-Realisation ends.  From iv.15 to iv.25, Patanjali takes the sadhaka progressively to the realisation that consciousness is not the all-knower, but simply an instrument of the soul.  For one who is not sure of the difference between consciousness and soul (citta and citi), an analogy is given; the blades of grass which shoot up during the rainy season prove the existence of the hidden seeds.  In this sutra Patanjali explains that the seed of the soul (atma bija) is sown at the right time for the knowledge of the soul (atma jnana) to be securely established. As one mistakes a rope for a snake at first glance, but realises upon examination that it is a rope, consciousness at this stage realises that it is not all-knowing, but an instrument of the soul. Avidya is vanquished and the practitioner thoroughly understands objective as well as subjective knowledge, without colourisation. Here all moods and modes cease to flow, and consciousness is elevated to the optimum degree to behold the inebriated state of the seer. The yogi is no longer drawn towards the temptations of the world. His search for the self ends. He becomes a master of yoga and a master of himself. He is yogesvara. This is the substance (svarupa) of yoga and a distinct attribute of the seer (visesa darsinah). For one who has experienced this distinction between seer and this subtlest mind, the false identities and even the curiosity about the nature of one's own self come to an end. After the yogi has explored the many currents and cross currents of the gross and subtle mind, there comes the realization of the separateness from all of these levels and pure consciousness. It is then, that all of these questions cease. It is not a case that they are analytically answered in logical words. Rather, the questions are resolved; they simply evaporate in understanding. Patanjali is now explaining the nature of that yogi who has realized the distinction between the seer, the seen and the mind very clearly. In other words, he is now the viveki, the one proficient in discriminating faculty; the one who can perceive the truth and differentiate it from the one which is not – easily. At this stage, the mind also is the purest possible reflector of external reality, without any coloring either on itself  or on the scenery.  The seer, the Purusha, the pure consciousness knows this. He has experienced the external reality in its purest form, since no coloring affects it now. There are now no false identities.  There is not even any further curiosity about the nature of one's own self. There is complete cessation of all doubt between the seer, the seen and the nature of mind. There is a complete cessation of any desire, including the desire to reside in the Purusha. The pure mind has come close to the Purusha and is accepting his Mastery. To one who sees the distinction between the mind and the Atman, thoughts of mind as the Atman cease forever. For one who realizes the distinction between citta and atma, the sense of separation between the two disappears. The man of discrimination ceases to regard the mind as the Atman. For one who has experienced this distinction between seer and this subtlest mind, the false identities and even the curiosity about the nature of one's own self come to an end.




4.26- - tada vivekanimnan kaivalyapragbharan chittam


Then consciousness is drawn strongly towards the seer or the soul due to the influence  of the exalted intelligence.


When the exalted intelligence is ablaze, consciousness is illumined; it becomes free and tinged with the divine (citta suddhi). Due to this divine light, citta, with its exalted intelligence, is attracted as if by a magnet towards its source - the indivisible seer who is alone, free and full. Before reaching the state of exalted intelligence, consciousness is attracted more towards the pleasures of the world. When intelligence is free from doubts and prejudices, it gravitates towards the absolute seer. As a farmer builds dykes between his fields to regulate the flow of water, similarly, exalted intelligence builds a dyke for the consciousness, so that it does not move again towards the world, but turns and flows towards union with the divine seer. This is kaivalya, an existence filled with freedom and beatitude. Such a yogi becomes a king amongst men. Viveka means clear discrimination between Truth and what is not truth. Truth liberates from ignorance, while what is not truth binds the sadhaka to Ignorance. The mind-field is always looking outward through the senses and its perception is always coloured. But, once the coloring is removed, the mind-field, the Chitta also becomes a clear, pure receiver of external wisdom because of the illuminating power that it has received from the Purusha.  Now, mind is inclined towards clear viveka or discrimination faculty in its power of perception and therefore, the ignorance binding it, comes down and down and tends to remove the veil of ignorance from the Purusha. Purusha is now shining clearly. Mind also therefore gravitates towards total liberation. What is the liberation? It is nothing but the dropping of all barriers to wisdom, the barriers to truth that had arisen in mind due to the covering of Ignorance. What is the ignorance of the mind-field? It is its identification with the body-mind complex. Once the self realizes that it is not the body-mind complex, the barriers covering the mind-field drop away easily. The mind-field should detach from the drisya and become and efficient aid of the real Master, the Prabhu, the Purusha, the self, the consciousness. Now, all barriers drop off. Discrimination, viveka comes home automatically. Renunciation, vairagya and liberation happen effortlessly, effectively and automatically. Then the mind is inclined towards the highest discrimination, and gravitates towards absolute liberation between seer and seen. When even the subtlest questions of life subside, there is only one direction left to go, and that is towards the realization of the absolute reality that is beyond. This is not a case of a lethargic mind having no question about the meaning of life; such a mind has not even entered the path of Self-realization. Rather, it comes from having questioned, explored, searched, and longed, through the gross, subtle, and causal levels, until finally, the point of the final discrimination stands in front of the seeker. When the mind is bent on the practice of discrimination, it moves toward liberation. And their clarity takes them to their only concern; to reach and remain in a state of freedom.  The yogi has to achieve this.  It does not come by wishful thinking.  Only through higher yoga can this be achieved consistently. Practice of Yoga leads to discriminating power, to clearness of vision. The veil drops from the eyes, and we see things as they are.  When discrimination comes by long practice fear ceases, and the mind attains isolation.






4.27- - tachchhidreshu pratyayantarani sanskarebhyah



Notwithstanding this progress, if one is careless during the interval, a fissure arises due to past hidden impressions, creating division between the consciousness and the seer.



The force of past impressions may create loopholes in the form of intellectual pride or other varying moods or modes of thought, which breach the consciousness and agitate the harmony and serenity of oneness with the pure Self (atmabhava). This sutra shows a way to fight old impressions that may influence the consciousness and crack it. Patanjali cautions that even for the supreme intelligence, the subconscious samskaras may surface in this intermediate stage and sway the consciousness. Patanjali advises yogis who wish to be released from worldly life to be incessantly vigilant in order to overcome these old habits, lest their consciousness wavers between the desire for perfection and actual perfection. The uninterrupted practice of yoga unconditionally crushes these fissures in consciousness, and eliminates doubts and prejudices, so that pure wisdom may shine. In the Bhagavad Gita 11.59, Lord Krishna says that inbuilt desire persists as a fissure even in the most austere renunciate. Only the vision of the Supreme resolves these latent faults forever. From that moment no worldly desire or temptation can endanger the composure and virtue of the yogi .Patanjali says, even at this point, there will be some very deep impressions, very deeply ingrained Samskaras, which rise again and again to pull down the viveka and put barriers in its path. This happens many times. This is because, some of these deepest, ingrained samskaras  take time and effort to be totally rooted out. The same methods already gone through for removal of samskaras must be continued to be adopted  till the last remnants are rooted out. For this, retaining a high level of awareness of them is however essential. When there are breaks or breaches in that high discrimination, other impressions arise from the deep unconscious. The clarity of discrimination can once again be clouded over. This temporary loss of the ground attained is one of the predictable obstacles of the path of enlightenment. The way to deal with this is the same as it was before the discriminative enlightenment . In the relaxation of the focus, other mind contents arise in the intervals.  These are based on subtle impressions. The yogi faces failures at every step but he must forge ahead.



4.28- - hanam esham kleshavaduktam


In the same way as the sadhaka strives to be free from afflictions, the yogi must handle these latent impressions judiciously to extinguish them.



The gap between consciousness and the seer can rear disharmony and disturbance in one's self. As fire is deprived of fuel, likewise, the yogi has to remove the latent impressions from the consciousness and extinguish them, for it to be in harmony with the seer. Patanjali advises the yogi to eliminate disturbances by reintroducing yogic disciplines with faith, vigour and vitality. As the sadhaka earlier strove to rid himself of the sufferings of avidya, asmita, raga, dvesa and abhinivesa, the exalted yogi must, through practice, press, dry out and close the perforations in the consciousness. iv. 27 stated that subconscious impressions surface in the form of intellectual pride, which hinders progress towards the goal of union with the divine seer. As roasted seeds do not germinate, so the fire of wisdom must burn out impressions and ambitions, ending their power to generate disturbing thoughts, so that the consciousness maintains its union with the seer forever. Patanjali has taught us all the methods for removal and rooting out of kleshas like ignorance and suffering throughout the Yoga Sutras earlier. The removal of the remaining kleshas also needs to be done by the same methods.  First, you seek enough purity of mind and body that you can experience the highest. Then, after that direct experience, the way in which you relate to samskaras and karma is vastly different. You have glimpsed the highest, and knowing that, the purifying process. One must never accommodate even small errors because they are as detrimental as the five obstacles.  Each yogi has to endure and overcome this inner conflict alone.



4.29- - prasankhyanepyakusidasy sarvathavivekakhyater dharmameghah samadhih


The yogi who has no interest even in this highest state of evolution, and maintains supreme attentive, discriminating awareness, attains dharmameghah samadhi.   He contemplates the fragrance of virtue and justice.


When the stream of virtue pours in torrents and the consciousness is washed clean of bias, prejudice and ambition, the light of the soul dawns. This is dharma megha samadhi - the fruit of the practice of yoga.  If the yogi, knowing that the highest form of intelligence is also a hindrance, remains uninterested even in this enlightened wisdom as well as in spiritual attainments, virtuousness descends upon him like torrential rain, washing away his individual personality. His only ambition now is to sustain spiritual health. He has purity and clarity. His personality has been transformed. He becomes humane, universal and divine. He lives forever in dharma megha samadhi, unexcelled bliss.  A cloud has two facets. It may cover the sky without bringing rain. This makes the atmosphere gloomy and people become inactive and dull. But if the cloud bursts into rain, the atmosphere is cleared, the sun shines, and people go out to work gleefully. The yogi should not make the consciousness quiet in a tamasic way, but in an alert, satvic way to shine forth brilliantly to live in the delightful, fragrant rain-cloud of virtue.  He has renounced everything, and is a viveki (one who distinguishes the invisible soul from the visible world), ajnanin (sage), a vairagin (renunciate), and a bhaktan (divine devotee). Now he has attained nirbija Samadhi.  Omniscience or total knowledge is what man seeks to attain as the highest state possible for him. But, for yogi, even this omniscient state holds no interest at all. He does not hanker for it, nor does he feel proud when he knows he has it. Thereby, the yogi exhibits the highest possible state of discrimination. The Samadhi which he is in, in  this state is called Dharma Megha Samadhi, or the Samadhi of the cloud of virtue. This renouncement of the exalted state of omniscience is called paravairagya or the ultimate renunciation. One can renounce all desires – and go on desiring for moksha. But, one can renounce even this desire for moksha. This is the state of absolute desirelessness. No desires what so ever – no desire even for Moksha. The desire for Moksha, or liberation is the ultimate desire and even this desire is renounced to make desirelessness complete.  This state is the state of the ultimate discrimination. And the yogi will now be in this state forever. Patanjali calls this state as Dharma Megha Samadhi. Dharma means virtues, megha means clouds; Samadhi means the still, flickerless state at the end of dharana and dhyana. This dharma megha is going to remain flickerless and still with the yogi.  Dharma means virtues. All virtues have descended on the Yogi like a cloud from the sky. And, they will now remain still and flickerless with the Yogi. Why is this Samadhi called a cloud? This cloud also covers the vision of the Yogi from the clear sky of kaivalya.  Even if it is of virtues, it still covers the essential kaivalya, his total liberation, from the Yogi. So, to that extent, this too remains as the last barrier that the yogi must come out of. When there is no longer any interest even in omniscience, that discrimination allows the samadhi, which brings an abundance of virtues like a rain cloud brings rain. : There finally comes a point where discrimination has so thoroughly set aside all which is not Self that even the interest in omniscience is seen as only relatively real and not worthy of pursuit. Then comes the highest virtues: From that non-attachment to omniscience there comes the samadhi that brings an abundance of virtues like a rain cloud brings rain. The Self may have been glimpsed before, but the colorings of the deep impressions were still there. Now even those have been transcended. Peace, bliss,  and perfect purity becomes a yogi’s  own nature, after he has  given up all  vanities of powers.




4.30- - tatah kleshakarmanivrittih


Then comes the end of afflictions and of karma.


The effect of dharma megha samadhi is freedom, freedom from the five afflictions and fluctuations. It is the highest form of intelligence and evolution. From this rain-cloud of virtue, sufferings cease of their own accord and in their place, divine actions with no reactions flow forth like a river from the yogi. This is freedom. Avidya, the mother of afflictions, is eliminated, root and branch, along with residual subliminal impressions. The sadhaka will not deviate from the path of divinity nor perform an act that binds, hinders or preconditions his consciousness. He is free from the bondage of karma. In the Bhagavad Gita (V 1.5), Lord Krishna says that each individual has to cultivate himself to become enlightened, and to learn not to degrade himself, for the Self alone is the friend of the individual self, and the Self alone is the enemy of the egotistical self. As the light of a lamp fades as the oil runs out, so the lamp of the mind is extinguished as its fuel, the actions producing joys and sorrows, is exhausted. As nirmana citta is extinguished of its own accord, its root motivation is burnt out, leaving no opportunity for the production of effects The cycle of cause and effect is at an end, and the yogi is liberated from the grip of nature. Even in this liberated state, he will not relinquish his practices. He will continue to maintain them as a divine command, so that the freedom earned may not be lost by neglect. Patanjali says – if the yogi goes beyond even this barrier of virtuous cloud or Dharma megha, then, all the deepest impressions or samskaras in him dissolve totally and all the kleshas or sorrows, pains and afflictions cease totally and absolutely. Dharma megha Samadhi is thus the last barrier to cross for the successful yogi.After that dharma-meghah samadhi, the colorings of the kleshas and the karmas are removed. Burning the seeds of karma: This is the final dealing with the colorings (kleshas). First, the mind was stabilized . Then these colorings were reduced in their gross form , then they were dealt with in their subtle forms. These kleshas (colorings) moved through four stages of active, separated, attenuated, and then were reduced to seed form. Now, those seeds are parched, so as to not be able to grow again. First, there were glimpses of Truth, which had the effect of negating the obstacles . After a great deal of sadhana (spiritual practices), there came a temporary discriminative enlightenment that was accompanied by breaches . Now, with the neutralizing of the colorings of the samskaras that cause karma, the realization is finally firm of ground. The yogi rests in the True nature of the Self . From that samadhi all afflictions and karmas cease. After that dharma-meghah samadhi, the colorings of the kleshas and the karmas are removed. From that comes cessation of pains and works. When that cloud of virtue has come, then no more is there fear of falling, nothing can drag the Yogi down. No more will there be evils for him. No more pains  When the yogi reaches the causal level and sees the various clouds of energy (meghah) in which the dharmas or laws for righteous life, are created and maintained, he gets an ease in his higher yoga practice.  He smiles for he will never again fall into the trap of making spiritual missions to help or to save others




4.31- - tada sarvavarannamalapetasy jnanasyaanantyajgyeyam alpam


Then, when the veils of impurities are removed, the highest, subjective, pure, infinite knowledge is attained, and the knowable, the finite, appears as trivial.



The stream of virtue extinguishes all the veils of impurities. The yogi is devoid of doubts, preconceptions and prejudices. The infinite light of the soul illumines him continuously, and his consciousness and the seer become one. For him, knowledge gained through the organs of cognition and through consciousness are insignificant compared with the infinite wisdom emanating from the soul. This sutra describes the characteristics of the yogi who is devoid of afflicting actions. His head becomes clear and his heart clean and pure as crystal. When the clouds dissipate, the sky becomes clear. When the sun is bright, no other light is required. When the light of the soul blazes, the yogi does not need mind or intelligence to develop knowledge. . In this sutra, as the consciousness has been fully matured, he cautions the yogi that if fissures are formed in the cttta, afflictions will affect him instantaneously and not at a future time. His knowledge springs eternally from the seed of all knowledge (atman) and jnana gahga (perennial river of wisdom), and he perceives directly. The cover that has clouded the Jnanam is now totally removed. It is shining in its pristine purity and totality now.  The Jneyam, the thing to be known is now almost nothing. Or alpam. In this state, the Purusha starts functioning by himself, and mind merely remains without clouding his experience and vision. Purusha sees and experiences the reality totally. There are no barriers whatsoever for him now. It can also be said, he is now the reality himself. Then all the coverings and impurities of knowledge are totally removed. Because of the infinity of this knowledge, what remains to be known is almost nothing. The, when the veils of impurities are removed, the highest, subjective, pure, infinite knowledge is attained, and the knowable, the finite, appears as trivial. Then the whole universe, with all its objects of sense-knowledge, becomes as nothing in comparison to that infinite knowledge which is free from all obstructions and impurities. When the mind is free from the clouds that prevent perception, all is known, there is nothing to be known.  When those veils are only temporarily removed or set aside, the process of purifying continues, recalling that instructions were even given on how to deal with breaches in enlightenment .  First comes the direct experience of the infinite. It might be only a glimpse, but even that glimpse may qualitatively reveal the height of Truth . Then comes knowledge: One of the results of that direct experience is the knowledge of the simplicity of things, that there really is little to know. Then keep purifying: After that realization, we then continue with renewed conviction the process of removing karma, etc. Karma is removed: Finally, all karma is removed through the coming of the rain cloud of virtues described in the previous sutra.  The realization that there is little to know is deliciously amusing, amazing, wonderful, and filled with joy.  These insights come because of seeing the nature of the gunas , the way the subtle mind operates, and realizing the higher discrimination. Then knowledge, bereft of covering and impurities, becoming infinite, the knowable becomes small.  Knowledge itself is there; its covering is gone. 




4.32- - tatah kritarthanan parinamakramapari samaptirgunanam


When dharma megha samadhi is attained, qualities of nature (gunas) come to rest. Having fulfilled their purpose, their sequence of successive mutations is at an end.



Having transformed the yogi's consciousness by the radiation of the rays of the soul, the orderly mutations and rhythmic sequences of the qualities of nature, sattva, rajas and tamas come to an end. Their tasks are fulfilled, and they return to nature. The essence of intelligence and the essence of consciousness both now retire to rest in the abode of the soul. The master, the seer or the soul, is independent. He keeps the gunas in suspension, or uses them when necessary. They enthusiastically serve him as committed servants, without influencing him as before, and without interfering in his true glory. Now the three primary gunas have totally fulfilled their purpose for him. They are no more needed for the enlightened yogi. He has transcended all their use. Ordinarily, the three Gunas are the ones, which go on creating an ordered sequence of events for the sadhaka, which he has to go through all his life.  Now, the Yogi has transcended that ordered sequence of events and transformations. There is no more need for them in his life. He is beyond all the three Gunas. Therefore, having fulfilled their part in his life, the gunas recede back into the essence from which they have come. They, which means, the world of three Gunas, no more undergoes any transformation in the experience of the enlightened Yogi. The Purusha had jumped from the Divine into the world of prakruthi. There he learnt all the lessons that prakruthi had to offer; He was covered by the Maya, of the three Gunas, which were constantly transforming his world. But, as yogi, he began coming out from one barrier after another, set for him by the Maya. The ultimate barrier of dharma megha also having been transcended, the Purusha is back into the divine. The whole prakruthi of the three Gunas, cannot any more, set any barriers for him.  He is now a muktha Purusha. Also resulting from that dharma-meghah samadhi, the three primary elements or gunas  will have fulfilled their purpose, cease to transform into further transformations, and recede back into their essence. The interplay of the three gunas were earlier seen to be the cause for pain , and sadhana was done so as to discard this pain before it comes. The coming of the dharma-meghah samadhi also brings to an end the need for the three subtle transitions previously discussed . Thus, the subtle material nature, having fulfilled its purpose, its progressive alterations end. When dharmameghah samadhi is attained, qualities of nature (gunas) come to rest. Having fulfilled their purpose, their sequence of successive mutations is at an end. The three basic qualities cease to follow the sequence of alternating pain and pleasure.  Resulting from that dharma-meghah samadhi , the three primary elements or gunas  will have fulfilled their purpose, cease to transform into further transformations, and recede back into their essence.





4.33- - kshannapratiyogi parinamaparantanigrarhyah kramah


As the mutations of the gunas cease to function, time, the uninterrupted movement of moments, stops. This deconstruction of the flow of time is comprehensible only at this final stage of emancipation.



The sequence of time is related to the order of movements of the gunas of nature. Only the yogi recognises this inter-relationship and is free from gunas. The uninterrupted succession of moments is called time. These movements of moments and the uninterrupted mutation of the gunas of nature are distinctly recognisable at the culminating point of transformation. The average person is not aware of moments - he understands their movement as past, present and future. When moments sup away from one's awareness, one lives in movements. Memory begins to exert its influence, and consciousness is felt at this juncture in the movements of time. The perfect yogi lives in the moment without getting involved in movements - the movements of moments are arrested, and psychological and chronological time comes to an end. Living in the moment, the yogi sees the seer. This is evolution. Nature eternally helps the intelligence and consciousness towards evolution (parinama nityan), whereas the seer remains eternally changeless (kutastha nityan). Evolution takes place in a moment. Moment implies instant while movement implies time. When change comes, it arrives at once in a moment, only after a series of efforts involving movements of time. Transformation does not come without effort. As change is noticeable to an average individual, so the end transformation is distinguishable to a yogi by virtue of his pure wisdom - dharma megha samadhi. He is free from time, place and space, while others remain trammeled in this net. He is neither attracted towards nature nor disturbed by it. He is now a divine yogi. Every change is clearly perceived only at the end of the transformation process. Not, when the change was happening from moment to moment. It is true that each moment presents a point of change in any ordered sequence of changes. But, the perception of the change is really clear, only when the sequence ends. All the three Gunas need to undergo the full change  - and then, the full change becomes comprehensible. This implies two things. (1) Every moment a part of the total change is taking place. But, in that moment, the change is not comprehensible. (2) At some point, a total change has been completed – and it becomes perceptible and comprehensible. For the Yogi, the three Gunas have stopped their transformation process. This means, the total change is visible, experience-able, and knowable for the Yogi. But, the same has not happened for all others. For all others, the change continues; the transformation continues; and every moment, there is change; they are not able to see the change that will come tomorrow. But, not so, for the yogi who has gone beyond the dharma megha Samadhi. For him, there is no further transformation, which is hidden from him.  All changes are known to him. The sequencing process of moments and impressions corresponds to the moments of time, and is apprehended at the end point of the sequence. Here, in this sutra, time is being described as the uninterrupted sequence or order of the many impressions in the field of mind. It is this sequencing that brings the appearance of time. Think of a reel of movie film. You can hold it, and all of the frames in your hand, at one moment of time, and yet, when you play the movie through a projector, you create the appearance of time. It is because of the sequencing of the frames, one after the other, that there appears to be time. The "Aha!" moment of understanding a sequence of moments, impressions, or frames comes at the end of the sequence. Recall that great emphasis is placed on these transition moments in sutras. When you can see these moments at the end of the sequence, you come to understand the transformation process itself, and can see beyond the avidya or ignorance that veils the true self.  Break the pattern of sequencing to transcend time: Most of the time, we are caught up in time, identified with those thought patterns, whether gross or subtle in nature. Now, in these last few sutras, all of those patterns have been reduced to their primal reality, that of the three gunas. If you break the identity with the patterns, and the sequencing process, then you break the process of time, space, and causation. The process, of which moments are a counterpart, and which causes the alterations, comes to an end and is clearly perceived.The advanced yogi alone achieves this.  This is an individual accomplishment, where the yogi sees the moments, which in sequence make up time which is itself the changing mundane energy (gunanam).  The yogi clearly perceives this from afar.  What hypnotizes other and keeps them under its control subjectively and objectively, is looked upon by the yogin, just as the God would normally see it.As the mutations of the gunas cease to function, time, the uninterrupted movement of moments, stops. This deconstruction of the flow of tie is comprehensible only at this final stage of emancipation. This is the sequence of the mutations which take place at every moment, but which are only perceived at the end of a series.  A sequence is the replacement of one characteristic by one that follows it. This is linked to moment. A replacement of characteristics is also the basis of moment.



4.34- -- purusharthashoonyanan gunanan pratiprasavah kaivalyan, svaroopapratishtha va chitishaktireti


Kaivalya, liberation, comes when the yogi has fulfilled the purusarthas, the fourfold aims of life, and has transcended the gunas.



The yogi with the stream of virtuous knowledge is devoid of all aims of life as he is free from the qualities of nature. Purusarthas are man's four aims in life - dharma (science of duty), artha (purpose and means of life), kama (enjoyments of life) and moksa (freedom from worldly pleasures). They leave the fulfilled seer and fuse in nature.  Patanjali speaks of the purusarthas only in the very last sutra. His thoughts on the purusarthas are implicitly contained in the earlier chapters, and expressed clearly at the end. Thus, the four padas are, consciously or unconsciously, founded on these four aims and stages of activity.  Dharma is the careful observation of one's ethical, social, intellectual and religious duties in daily Life. Strictly stating, this is taught at the level of studentship, but it must be followed throughout life; without this religious quality in daily life, spiritual attainment is not possible.  Artha is acquisition of wealth in order to progress towards higher pursuits of life including understanding the main purpose of life. If one does not earn one's own way, dependence on another will lead to a parasitic life. One should never be greedy while accumulating wealth, but only to meet one's needs, so that one's body is kept nurtured and one may be free from worries and anxieties. In this stage one also finds a partner with whom to lead a householder's life. One comes to understand human love through individual friendship and compassion, so that one may later develop a universal fellowship leading to the realisation of divine love. The householder is expected to satisfy his responsibilities of bringing up his children and helping his fellow men. Thus, married life has never been considered a hindrance to happiness, to divine love or to the union with the Supreme Soul.  Kama means enjoyment of the pleasures of life, provided one does not lose physical health, or harmony and balance of mind. The Self cannot be experienced by a weakling, and the body, the temple of the soul, has to be treated with care and respect. Asana, pranayama and dhyana, therefore, are essential to purify the body, stabilise the mind and clarify the intelligence. One must learn to use the body as a bow, and asana, pranayama and dhyana as arrows to be aimed at the target - the seer or the soul. Moksa means liberation, freedom from the bondage of worldly pleasures. It is the experience of emancipation and beatitude, possible only when one is free from physical, psychological, intellectual and environmental afflictions , and from poverty, ignorance and pride. In this state one realises that power, knowledge, wealth and pleasure are merely passing phases. Each individual has to work hard to free himself from the qualities of nature (gunas) in order to master them and become a gunahtan. This is the very essence of life, a state of indivisible, infinite, full, unalloyed bliss. These aims involve virtuous actions and are linked with the qualities of nature and the growth of consciousness. When the goal of freedom is attained, the restricting qualities of consciousness and nature cease to exist. At this point of fulfilment, the yogi realises that the seeker, the seer and the instrument used to cognise the seer is atman. This absoluteness of consciousness is nothing but the seer. Now, he is established in his own nature. This is kaivalyavastha.  The practice of yoga serves every aim of life. Through the proper use of the organs of action, senses of perception, mind, ego, intelligence and consciousness, their purpose of serving their Lord, the seer, comes to an end, and these vestments of the seer, along with the qualities of nature, coil and withdraw, to unite in the root of nature (mula-prakrti).  There, they are held and isolated. By this, the citta becomes pure and supreme. In this supreme state, citta divinely merges in the abode of the seer so that the seer can shine forth in his immaculate, pure and untarnished state of aloneness. Now, the yogi shines as a king amongst men. He is crowned with spiritual wisdom. He is a krtarthan - a fulfilled soul, who has learned to control the property of nature. He brings purity of intelligence into himself. He is now free from the rhythmic mutation of gunas, of time, and thus released from aims and objects, as his search for the soul ends. All the twenty-four principles of nature move back into nature and the twenty-fifth, the seer, stands alone, in kaivalyam. He is one without a second; he lives in benevolent freedom and beatitude. With this power of pure consciousness, citta shakti, he surrenders completely to the seed of all seers, Paramatma or God. Lord Krishna, in the Bhagavad Gita (XVIII.6I-62), explains that 'the Supreme Ruler abides in the hearts of all beings and guides them, mounting them on wheels of knowledge should seek refuge by surrendering all actions as well as himself to the Supreme Spirit or God' so that he journeys from Self-Realisation towards God-Realisation.  Patanjali began the journey towards the spiritual kingdom with the word atha, meaning 'now'. He ends with the word iti, meaning 'that is all'. The yogi has reached his goal. The whole drama of the world goes on due to the emergence of the three gunas (or prakruti) as the coverage or aavarana around the Purusha – making him dance with the mind-field and its vrittis. Now, they have resolved back into their original form into the prakriti, leaving the Purusha free from the covering, or from the barriers created by them. The Chitta vrittis were the barriers. Purusha has scored a total victory over them now. Therefore, the three Gunas resolve back to their original position in the Prakriti. The yogi has conquered the chitta vrittis completely. He is now liberated from all of them, totally. He has emerged enlightened . He is now established in his original nature. This is kaivalya. When those primary elements involve, or resolve themselves back into that out of which they emerged, there comes liberation, wherein the power of pure consciousness becomes established in its true nature. When those primary elements or gunas involve, or resolve themselves back into that out of which they emerged, there comes liberation, wherein the power of pure consciousness (purusha) becomes established in its true nature . Such an enlightened Yogi is purely spontaneous, with no actions whatsoever being motivated by the inner drives of samskaras and karma. One hundred percent of actions are from the here-and-now response to the needs of the moment, in relation to the service of other beings. This is easy for such a yogi, as there is no I and no other; it is all a constant flow of pure, undivided consciousness (purusha), that only seems to play, here, there, and everywhere. Kaivala, liberation, comes when the yogi has fulfilled the purusarthas, the fourfold aims of life, and has transcended the gunas. Aims and gunas return to their source, and consciousness is established in its own natural purity. Since the gunas no longer have any purpose to serve for the Atman, they resolve themselves into Prakriti. This is liberation. The Atman shines forth in its own pristine nature, as pure consciousness. When the highest purpose of life is achieved the three basic qualities do not excite responses in the mind. That is freedom. In other words, the Perceiver is no longer colored by the mind. When those primary elements involve, or resolve themselves back into that out of which they emerged, there comes liberation, wherein the power of pure consciousness becomes established in its true nature. 

Here ends the exposition of kaivalya, the fourth pada of Patanjali's Yoga Sutras.  

Patanjali Maharishi covered everything in the mystic practice of yoga.  All glories unto him.  





Hari!Om! Namaskaraha, Great Mr. Captain Sir, Very interesting and enlightening blog, yours. Best Wishes. I have to go through in depth and detail to offer views etc.


  1. hi vc,

    ALMOST ALL WRITERs ABOUT INDIAN YOGA HAVE WRITTEN THAT GANDHI IS A YOGI -- TO PLEASE ROTHSCHILDs MEDIA

    BALLS,  GANDHI WAS A YOGI !

    GANDHI IS UNFIT TO BE A YOGI -- HE HAS ZERO QUALIFICATIONS TO BE A YOGI . . I HAVE READ ALL OF GANDHIs WORKS -TWICE , TO SEE IF I MISSED ANYTHING . .

    GANDHI HAS FOOLED THE WHOLE PLANET, BUT HE CANT FOOL CAPT AJIT VADAKAYIL

    SO WHAT IS SPECIAL ABOUT CAPT AJIT VADAKAYIL?

    HE DOES NOT JUMP INTO THE BANDWAGON ..

    HE DOES NOT CARE FOR THE OPINION OF THE MAJORITY.

    THIS IS THE REASON WHY HE HAS PRAISED THE "MOST EVIL MAN ON EARTH POL POT "-- THE ONLY WRITER  . .

    EVEN A RETARDED CHILD READING THE POST BELOW WILL KNOW WHAT I MEAN.

    http://ajitvadakayil.blogspot.in/2015/11/pol-pot-of-khmer-rouge-great-cambodian.html
    THE RICHEST MEN IN NORTH AMERICA WERE TEA IMPORTERS .

    THERE IS NO PROFIT MARGIN IN TEA -- TEA CHESTS CONTAINED OPIUM INSIDE

    IN THE POST BELOW I ASK -- WHY DID THE FREEMASONS DRESSED UP AS RED INDIANS NEED TO BREAK "EACH AND EVERY CHEST OF TEA"?

    IF THIS IS A SYMBOLIC PROTEST WHY BREAK EACH AND EVERY CHEST ?

    AND WHATEVER LOOSE TEA WAS THROWN INTO THE WATER , WHY DID BOATS HAVE TO GO AND PAT IT DOWN TO SINK IT ?

    THE RICHEST MEN IN AMERICA WERE ROTHSCHILDs OPIUM DRUG RUNNING AGENTS

    http://ajitvadakayil.blogspot.in/2010/12/dirty-secrets-of-boston-tea-party-capt.html
    SAME WAY THE RICHEST MEN IN INDIA WERE ROTHSCHILDs OPIUM DRUG RUNNING AGENTS

    http://ajitvadakayil.blogspot.in/2010/11/drug-runners-of-india-capt-ajit.html

    capt ajit vadakayil
    ..



STOP PRESS :

kancha ilaih SQUEAK nay shephard came on TV couple of years ago.

he was cracking up from within-- his voice quivered with sheer grief when he cried--THESE HINDU GODS ARE SO VIOLENT, THEY ARE ALL THE TIME KILLING PEOPLE

to this SQUEAK i must say " hindus gods are all cosmic allegories except vishnu avatars "

stop moaning that Brahmins did NOT allow shudras to learn vedas – this would be as irresponsible as a brain surgeon allowing his nurse to do brain surgery on a holiday .. vedas went on the oral route for 300 centuries, without losing a syllable , before they were penned down 70 centuries ago ..

CONDENSATION DOES NOT KILL EVAPORATION--THIS IS A CONCEPT MEANT FOR THE WISE--NOT IDIOTS.

http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html
devdutt pattanaik who does NOT understand sanatana dharama comes on TV serials aand denigrated hindusim.

he thinks that hindu gods are mortals , and their vahanas ( vimanas ) animals and birds.

see the way amish tripati converted shiva to be a tribal sex started mortal and the white man loved him for it.

devdutt pattanaik's attitude towards hinduism can be gauged from the post below--

read the part n blue italics- where shiva is hiding from nandi bull who is waiting in ambush to rape shiva anally . . . reciprocation if you please . .

http://ajitvadakayil.blogspot.in/2014/01/nandi-bull-vahana-and-gatekeeper-of.html
if he did the same in saudi arabia to islam he would have been beheaded on the streets within an hour.

this blogsite asks TIMES OF INDIA e-newspaper to stop denigrating Hinduism daily vide its SPIRITUALITY COLUMN.

devdutt pattanaik must know there is no heaven and hell in Hinduism.

somebody asked me about old people-- even from kerala-- going to KASHI GHATS to die.

well in olden days due to the saraswati river underground component, there was a MOBIUS COIL water flow at the ghats . people whose souls departs from this massive SCALAR FIELD gets a boost of ONE astral layer

same with kailash mountain-- pandavas walked to mount kailash before they died.

pyramid shaped mount kailash has an ORGONE FIELD due to the golden mean of 1.618 .

http://ajitvadakayil.blogspot.in/2010/12/secrets-of-egyptian-pyramids-revealed.html

THIS BLOGSITE WARNS JNU COMMIE PROFESSORS, NOT TO COOK UP FALSE STORIES ABOUT SANATANA DHARMA . .

WE DONT WANT COMMIES TO SAVE INDIA..

capt ajit vadakayil
..

TO BE CONTINUED --


CAPT AJIT VADAKAYIL
..

166 comments:

  1. DESH DROHI FOREIGN FORCES CHOOSE OUR COLLEGIUM JUDGES . . .

    EVERY TIME OUR UNIFORMED MEN RISK THEIR LIVES AND ARREST TERRORISTS , NAXALS AND SEPARATISTS - -OUR COLLEGIUM MELORDS WHO ARE AFRAID OF JEW NOAM CHOMSKY SAVE THEM . . ..

    WE DO NOT WANT JUDICIARY TO PLAY GOD IN INDIA . .

    INDIA IS THE ONLY NATION ON THIS PLANET , WHERE COLLEGIUM JUDICIARY ELECTS JUDGES . .THEY SCUTTLED NJAC . . .

    BEFORE 1947 ALMOST ALL OUR JUDGES WERE IN THE PAYROLL OF JEW ROTHSCHILD . . .

    INDIAN LAWS ARE BEING MADE AND BROKEN AT WILL BY A MERE PIL FILED BY DESH DROHI TROJAN HORSE NGOs . . THOUGH JUDGES DO NOT HAVE THE POWERS TO LEGISLATE LAWS. ..

    WE KNOW COLLEGIUM JUDGES HAVE FOREIGN SUPPORT WHEN THEIR LEGISLATE , DO EXTREME JUDICIAL OVERREACH . . . . . .

    OUR COLLEGIUM JUDICIARY BURNT MIDNIGHT OIL TO OPEN CHAMIYA BARS ( WH0RE HOUSES IN MUMBAI ).....

    BREADWINNERS OF THOUSANDS OF FAMILIES HAVE BEEN AWITING JUSTICE AS UNDERTRIALS FOR DECADES . . .

    BHARATMATA IS RACING TO BE THIS PLANETS NO 1 SUPERPOWER IN 17 YEARS --BEFORE THAT THE NEW WORLD ORDER WANTS INDIA TO IMPLODE. .. . . . . . .

    PM MODI CAN BE ABUSED LEFT AND RIGHT AND CALLED PSYCHOPATH --THE COLLEGIUM MELORD JUDGE SAID - - IT IS NORMAL - - - BECAUSE THERE WERE NO VIOLENT RIOTS -- . .

    The GRAVE implication is, WE COLLEGIUM JUDGES CONTROL INDIA. . . Almost all media barons run their own foreign funded NGOs and they can trigger violent riots and then get the collegium judge to ACT AND JAIL ANYBODY . .

    WHEN DID YOU LAST SEE THE BENAMI MEDIA/ COLLEGIUM JUDICIARY/ NEW WORLD ORDER CONTROLLED RAJYA SABHA SUPPORTING THE WATAN ? . .

    STOP THE SALARIES OF THE JUDGES WHO BREAK THE CONSTITUTION AND WITHDRAW THEIR SECURITY . . .

    READ ALL 7 PARTS OF THE POST BELOW -
    punch into Google search -- -
    . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .

    capt ajit vadakayil

    ReplyDelete
  2. I ASK THE PEOPLE OF INDIA--

    WHEN DID --

    COMMIE PRAKASH KARAT AND HIS WIFE BRINDA KARAT


    COMMIE SITARAM YECHURY AND HIS WIFE SEEMA CHISTI ( INDIAN EXPRESS RESIDENT EDITOR )

    COMMIE D RAJA , HIS JNU DAUGHTER AND HIS COMMIE WIFE

    SAY SOMETHING SUPPORTING THE WATAN LAST ?

    WHEN DID BRINDA KARATs BROTHER IN LAW , PRANNOY JAMES ROY ( WITH AN IRISH MOTHER ) LAST SUPPORT THE WATAN?


    WHY IS THE MODI GOVT AFRAID OF THIS COMMIE BUNCH ?

    WE THE PEOPLE OF INDIA WANT AN ANSWER

    ReplyDelete
  3. Namastey captain
    Over 65 Percent of U.S. Has Unsafe Levels of Toxic Chemicals in Drinking Water
    Read more at
    http://www.wakingtimes.com/2016/08/10/65-percent-u-s-unsafe-levels-toxic-chemicals-drinking-water/#PKeULkZBZ338rP8F.99

    http://www.wakingtimes.com/2016/08/10/65-percent-u-s-unsafe-levels-toxic-chemicals-drinking-water/

    ReplyDelete
  4. Dear Captain,

    Reading your blog has become ritual, like morning prayers. :)

    Thanks,
    Ninad

    ReplyDelete
    Replies
    1. YOU ARE NOT ALONE

      IN INDIA POLITICIANS, JUDGES, POLICE, BUREAUCRATS , STUDENTS -- ALL READ MY BLOGS BEFORE THEY OPEN THE MORNING NEWSPAPER

      WHAT IS A MORNING NEWSPAPER ?

      A BUCKET OF SHIT--- FULL OF LIES !

      Delete
    2. My morning newspaper is Ajitvadakayil blogspot

      Thanks,
      Praveen

      Delete
    3. Yooooo CAPTAIN,

      This is eternal truth millions would agree this in silence that they read your blogs 1st thing in morning. No doubt about it...

      Thanks

      Delete
  5. http://timesofindia.indiatimes.com/home/environment/pollution/Art-of-Living-event-completely-destroyed-Yamuna-floodplains-expert-committee-tells-NGT/articleshow/53734133.cms

    THE YAMUNA EVENT WAS FOR TRIPLE ENZYME SRI TO SET A GUINESS BOOK OF WORLD RECORDS AND TO PERSONALLY SHINE.

    SRI SRI RAVISHANKAR HAD THE GALL TO LIE ON TV , THAT HIS SOUR VINEGAR MADE OUT OF ROTTEN VEGGIES / FRUITS / PEELS IS AN ENZYME

    SANATANA DHARMA DOES NOT ALLOW ANY GURU TO MILK HINDUISM AND LIVE IN LUXURY.

    SRI SRI RAVISHANKAR HAS THE HIMMAT TO PUSH HOMOSEXUALITY WHILE QUOTING OUR ANCIENT SCRIPTURES.

    THIS ROGUE THOUGHT THAT DAMAGING THE JAMUNA BANKS IS AS EASY AS PUSHING HIS FAKE SHAKTI OIL IN IIT.

    ReplyDelete
    Replies
    1. http://ajitvadakayil.blogspot.in/2016/07/sanatana-dharma-hinduism-exhumed-and_31.html

      I WANT ALL MY READERS TO READ THE POST ABOVE AGAIN

      BAD DAYS HAVE STARTED FOR SRI SRI RAVISHANKAR . .

      NEXT TIME HE GOES TO SOUTH AMERICA AND A COUPLE OF COUNTRIES IN EUROPE THERE ARE ANGRY PEOPLE WHO WILL GET HIM ARRESTED FOR CAUSING BRAIN DAMAGE DUE TO HYPERVENTILATION ( SUDARSHAN KRIYA- SO HUM )

      Delete
    2. How captain??

      what happened??

      Thanks

      Delete
  6. Respected Captain Vadakayil
    Prashant Bhushan's NGO Common Cause has filed a petition in Supreme Court saying that sedition law is being used against activists to scuttle dissent. We are sick and tired of this anti-national traitor who is on payroll of foreign forces.
    Regards

    ReplyDelete
    Replies
    1. WELL --

      THE COLLEGIUM JUDICIARY IS MAKING AND BREAKING LAWS USING SUCH PILs FROM DESH DROHIS

      WHY HAS THE ELECTED EXECUTIVE NOT PUNISHED THE JUDICIARY ?

      PRASHANT BHUSHAN HAS USED PIL TO SUBVERT OUR CONSTITUTION . . THIS MAN HAS FOREIGN SUPPORT

      READ ALL 7 PARTS OF THE POST BELOW-

      http://ajitvadakayil.blogspot.in/2016/03/foreign-funded-trojan-horse-ngos-pil.html

      it is high time some foreign controlled collegium judges are thrown into jail

      capt ajit vadakayil
      ..

      Delete
  7. http://www.femina.in/relationships/love-sex/5-sexy-books-to-put-you-in-the-mood-17368.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA

    DIPPED IN SHIT

    ReplyDelete
  8. Pranaam Captain

    please explain about the Great Trigonometrical Survey of Indian sub continent did by the Rothschild agent Geroge Everest and british ,it is George everest who gave away the Hindu logic to Charles Babbage ,

    whats the mystery behind the goragaands obsession with Himalayas ? did they use Radhanath Sikdar as puppet to steal the ancient hindu scriptures ?
    what is this miracle of Non isostatic state of Himalayas ?

    ReplyDelete
    Replies
    1. Captain please reply ,why the british conducted Trigonometrical Survey ? what was their ulterior motive ?

      Delete
  9. http://timesofindia.indiatimes.com/india/India-rejects-Pakistans-proposal-for-foreign-secretary-level-talks-on-Kashmir/articleshow/53737505.cms

    INDIA MUST NOT TALK TO PAKISTAN OVER KASHMIR , EVER AGAIN . .

    ReplyDelete
  10. Captain,

    Devdutt's article on how a Shiva Linga is a symbolic worship of a phallus.

    http://www.dailyo.in/politics/devdutt-pattanaik-phallus-shiva-hinduism-mythology-gods-fertility/story/1/12380.html

    ReplyDelete
    Replies
    1. THIS BLOGSITE WANTS THE READERS TO KNOW THAT DEVDUTT PATTANAIK HAS DENIGRATED HINDUISM AND GOT AWAY

      Delete
  11. THIS BLOGSITE REMIND THE READERS

    WE AVE FORGOTTEN KARNAM MALLESHWARI

    SHE WOULD HAVE WON A GOLD AT THE 2000 SYDNEY OLYMPICS OLYMPICS , HAD NOT HER COACH ( DELIBERATELY ) SCREWED UP THE CALCULATIONS AND MADE HER LIFT EXTRA .

    SHE HAD TO SETTLE FOR OLYMPIC BRONZE.

    KARNAM MALLESHWARI IS THE FIRST INDIAN WOMAN TO WIN AN OLYMPIC MEDAL.

    SHE HAS STRENGTH IN HER GENES-- HER CHILDREN MUST BE SPONSORED BY THE INDIAN GOVT AND TRAINED FROM A YOUNG AGE, WITH PROPER DIET





    ReplyDelete
  12. http://timesofindia.indiatimes.com/sports/rio-2016-olympics/india-in-olympics-2016/miscellaneous/Olympics-vault-Khel-Ratna-for-Dipa-Karmakar/articleshow/53738536.cms

    WE ARE GRATEFUL TO DIPA KARMAKAR FOR MAKING US BELIEVE IN OURSELVES

    THERE WAS A TIME WHEN WE INDIANS FELT, WE WERE NOT GOOD ENOUGH IN SPORT LIKE GYMNASTICS

    THIS HUMBLE GIRL MAKES US PROUD

    SHE CANNOT BE EQUATED WITH ANY OTHER INDIAN ATHLETE , AS WHAT SHE DID WAS "ALONE" ON HER OWN STEAM AND IRON WILL.

    DIET IS VERY IMPORTANT DURING THE OLYMPIC GAMES-- THERE IS SOMETHING CALLED CARBOHYDRATE WITHDRAWAL ( RICE EATERS LIKE PT USHA )

    BOILED RICE EATERS MUST GET BOILED RICE-- NOT RAW RICE.

    I AM A BOILED RICE EATER-- KERALA MATTA RED RICE

    ReplyDelete
  13. http://timesofindia.indiatimes.com/india/PM-Narendra-Modis-new-Baloch-PoK-policy-is-that-of-a-novice-Salman-Khurshid/articleshow/53737400.cms

    WHO CARES FOR THE PRO-PAKISTANI DROHI SALMAN KHURSHID ! . . .

    ReplyDelete
  14. http://timesofindia.indiatimes.com/life-style/books/interviews/Can-we-ever-accept-adultery-in-India/articleshow/53738220.cms

    MOST OF THE PRESSTITUTES DO NOT KNOW WHO THEIR OWN FATHER IS . .

    THEIR PARENTS HAD AN OPEN MARRIAGE

    WE DONT CARE FOR THESE IMMORAL BASTARDS . .

    ReplyDelete
  15. http://www.femina.in/relationships/love-sex/sexy-ways-to-satisfy-your-mans-foot-fetish-12773.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    HOW ABOUT DIPPING FEET IN SHIT ?

    AAARGGHH PPTTHHEEOOOOYYY !

    TOILET PAPER OF INDIA HAS THE COLOUR OF SHIT AND SMELLS OF SHIT

    ReplyDelete
  16. http://timesofindia.indiatimes.com/india/India-rejects-Pakistans-proposal-for-foreign-secretary-level-talks-on-Kashmir/articleshow/53737505.cms

    INDIA MUST NEVER AGAIN TALK TO PAKISTAN ABOUT KASHMIR . .

    THOSE DAYS ARE OVER . . .

    ReplyDelete
  17. http://timesofindia.indiatimes.com/sports/icc-world-t20-2016/top-stories/ICC-rankings-India-displace-Australia-as-No-1-Test-team/articleshow/53738894.cms?

    WHO CARES ?

    NINE AND A HALF NATIONS PLAY CRICKET -- IF YOU ARE NOT FIRST ,YOU CAN BE LAST AND BE RANKED NINTH !

    ReplyDelete
  18. AMNESTY INTERNATIONAL IS FUNDED BY FOREIGN DESH DROHIS

    THEY HAVE THE SUPPORT OF BENAMI MEDIA, COLLEGIUM JUDICIARY, NHRC , NCM , NCW AND RAJYA SABHA

    WE DO NOT WANT COLLEGIUM JUDICIARY TO DEAL WITH SEDITION AND THREATS TO THE WATANA . .

    ReplyDelete
  19. Sir the Kerala new year which is being celebrated today is authentic or fake injected by white invader stooges .

    some of my kerala friends are saying that today one is authentic. I told them it is other way .

    Please clear the confusion sir

    ReplyDelete
    Replies
    1. http://ajitvadakayil.blogspot.in/2014/04/vishu-new-year-festival-of-kerala-capt.html

      Delete
  20. Captain sir,
    What do you think about our defence m Parrikar does he have the thing in him. Or just fooling us

    ReplyDelete
  21. Namastey captain
    Rothschild’s era
    https://youtu.be/wigDHjEwPuE

    ReplyDelete
  22. Pranaam Captain Saab,

    Dhanyavaad from my heart for all the profound truths revealed in your Sanatan Dharm blogs, also express gratitude to Rishi Patanjali.

    upon reading it i am reminded of following ....Mughal emperor Jahangir set his eyes on the valley of Kashmir. He said that if paradise is anywhere on the earth, it is here. When i instinctively realize the wisdom revealed in the Sanatan Dharma posts, this thought comes to my mind..if ever there was truth revealed on earth ..this is it this it..(i have read lot of material, but when i read your posts, i feel like going into deep dhyana, forgetting the external world).

    A sincere appeal to all the readers, please please find time from this material world and intellectually & spiritually comprehend & understand why exactly our great Captain Ajit has spent time , effort & mind to bring us the profound wisdom of Patanjali yog in simple easy to understand language. Like a wise Guru our dear Captain has our well being at heart. I wish Captain would start an Ashram to guide all the followers in true Sanatan Dharm, so that true Satyug would prevail on earth. and i know deeply captain would not get any material benefit out of this , unlike the other sham Gurus.

    May Parmatma bless our Captain with good health and well being so he can keep guiding us lost beings born in this confusing Kalyug.

    Best regards,
    Mel

    ReplyDelete
  23. An appeal to all youth of Bharat, Captain Ajit has revealed a science which is so valuable more than all the gora oriented education hifi degrees which are youth are so crazy about. This science revealed by Patanjali is the ultimate..amazingly formed in our great ancient bharat, to beat even the modern human created sciences of the goras. This goes to very depth to solve human condition, and not the superficial material sciences of the goras which only bring material comfort but destroys us from within. So leave all your distractions of modern life and pay attention to what Captain is saying.

    ReplyDelete
  24. Captain is like the wise Charioteer who is guiding us on the right path, away from malicious, distractive, disruptive & exploitative forces which want to dissipate our consciousness within. Captains Sanatan dharma blogs are like a beacon of light in this stormy sea of samsara, guiding is..read it passionately with interest like as its your last hope, a how do to manual to rescue you from the stormy seas of maya.

    ReplyDelete
  25. Islamist Terror in Pakistan and Religious Minorities - https://zcomm.org/znetarticle/islamist-terror-in-pakistan-and-religious-minorities-by-nasir-khan/

    ReplyDelete
  26. PV Sindhu vs Wang Yihan Highlights Rio Olympics

    https://www.youtube.com/watch?v=d_YcJIelbr0

    ReplyDelete
  27. Dear Sir, need your blog n views on treatment of water, specially on Jamnagar project, very recently Dr Swamy praised of this work.. My doubt is, will the govt take water supplies from plant production for their own consumption? Or can such water be exported to first world instead of the water from our holy rivers. I know you mentioned in one of your comment that this will have a bad affect in health as water holds memory. Please see if you can further explain this topic in a blog as only you can understand chemistry n who is sponsoring this work

    http://www.wabag.com/ru/wabag-projects/jamnagar-wastewater-recycling/

    http://www.geciczmp.com/jamnagar-sewerage-treatment-plant-project.aspx

    In anticipation of your response

    ReplyDelete
    Replies
    1. INDIA MUST NOT WORRY ABOUT POLLUTION IN NON STAGNANT WATER BODIES WHICH ARE BIODEGRADABLE.

      MODI PM TERM IS NOW HALF OVER-- TANNERIES OF KANPUR ARE STILL POLLUTING GANGES WITH CHEMICAL WASTE. THERE IS NO POLITICAL WILL.

      MODI HAS A USELESS MINISTER UMA BHARATI WHO PLAYS TO THE GALLERY, BUT CANT PRODUCE RESULTS.

      I AM A CHEMICAL TANKER CAPTAIN, I AM AWARE OF CHEMICAL POLLUTION.

      NOBODY ON THE PLANET GETS BETTER THAN A CHEMICAL SHIP CAPTAIN, IN WATER POLLUTION AWARENESSS

      http://ajitvadakayil.blogspot.in/2010/06/marpol-rules-for-annex-2-chemical_6733.html

      CAN UMA BHARTI , EVEN UNDERSTAND 10% OF THE POST ABOVE ?

      Delete
  28. Hi Captain,

    Deeply saddened, pls watch this video how our desi gaumata is picked up from the street of gujarat for beef export the car has gujarat number plate and this happened 2 days ago, i dont know whom to protect holy cow or these so called non (dalits) i insist u must say something.

    https://www.facebook.com/mahi.mewada.9/videos/690444707786423/

    thanks
    vkv

    ReplyDelete
    Replies
    1. WHEN THERE IS A LAW, THE GOVT MUST ENFORCE IT

      EVEN MOGHUL INVADERS HAD A POLICY OF NOT ALLOWING BEEF CONSUMPTION.

      PUNISHMENT MUST HURT !

      Delete
  29. Hari!Om! Namaskaraha, Great Mr. Captain Sir, Very interesting and enlightening blog, yours. Best Wishes. I have to go through in depth and detail to offer views etc.

    ReplyDelete
    Replies
    1. hi vc,

      ALMOST OFF WRITERs ABOUT INDIAN YOGA HAVE WRITTEN THAT GANDHI IS A YOGI-- TO PLEASE ROTHSCHILDs MEDIA

      BALLS HE IS A YOGI !

      HE IS UNFIT TO BE A YOGI -- HE HAS ZERO QUALIFICATIONS TO BE A YOGI . . I HAVE READ ALL OF GANDHIs WORKS -TWICE , TO SEE IF I MISSED ANYTHING . .

      GANDHI HAS FOOLED THE WHOLE PLANET, BUT HE CANT FOOL CAPT AJIT VADAKAYIL

      SO WHAT IS SPECIAL ABOUT CAPT AJIT VADAKAYIL?

      HE DOES NOT JUMP INTO THE BANDWAGON ..

      HE DOES NOT CARE FOR THE OPINION OF THE MAJORITY.

      THIS IS THE REASON WHY HE HAS PRAISED THE "MOST EVIL MAN ON EARTH POL POT "

      EVEN A RETARDED CHILD READING THE POST BELOW WILL KNOW WHAT I MEAN.

      http://ajitvadakayil.blogspot.in/2015/11/pol-pot-of-khmer-rouge-great-cambodian.html

      THE RICHEST MEN IN NORTH AMERICA WERE TEA IMPORTERS .

      THERE IS NO PROFIT MARGIN IN TEA -- TEA CHESTS CONTAINED OPIUM INSIDE

      IN THE POST BELOW I ASK -- WHY DID THE FREEMASONS DRESSED UP AS RED INDIANS NEED TO BREAK "EACH AND EVERY CHEST OF TEA"?

      IF THIS IS A SYMBOLIC PROTEST WHY BREAK EACH AND EVERY CHEST ?

      AND WHATEVER LOOSE TEA WAS THROWN INTO THE WATER , WHY DID BOATS HAVE TO GO AND PAT IT DOWN TO SINK IT ?

      THE RICHEST MEN IN AMERICA WERE ROTHSCHILDs OPIUM DRUG RUNNING AGENTS

      http://ajitvadakayil.blogspot.in/2010/12/dirty-secrets-of-boston-tea-party-capt.html

      SAME WAY THE RICHEST MEN IN INDIA WERE ROTHSCHILDs OPIUM DRUG RUNNING AGENTS

      http://ajitvadakayil.blogspot.in/2010/11/drug-runners-of-india-capt-ajit.html

      capt ajit vadakayil
      ..

      Delete
  30. Namastey captain
    http://m.indiatimes.com/sports/rio-olympics/sakshi-malik-ends-india-s-medalless-streak-in-rio-clinches-bronze-in-wrestling-260179.html
    Finally we arrived. .india got broonze.
    Sakshi sister ,we are proud of u .
    Happy rakshabandhan

    ReplyDelete
  31. Dear Captain,
    Can you post on Avani avittam and significance of poonulu

    ReplyDelete
  32. SAKSHI MALIK SHOWED INDIA THE MEANING OF FIGHTING TILL THE LAST SECOND

    WE ARE PROUD OF HER

    ReplyDelete
  33. WHEN REGULAR DRINKERS STOP GETTING BOOZE THEY WILL GO FOR HOOCH . .

    EVERY LABOURER IS ALLOWED A DRINK AFTER WORK TO RELEASE STRESS IN HIS KNOTTED UP MUSCLES

    SOMETIMES AFTER A LONG DRIVE , THE FIRST THING AS SOON AS WE REACH THE DESTINATION , IS MY WIFE GIVING ME A CHILLED BEER. I DONT EVEN HAVE TO ASK FOR IT .. .

    ANY GOVT WHO ENFORCES PROHIBITION, MUST TAKE RESPONSIBILITY FOR ILLEGAL HOOCH , AND THE CM MUST TAKE PERSONAL RESPONSIBILITY

    WE KNOW WHAT AN OPPORTUNIST NITISH KUMAR IS .- HE JUST WANTS VOTES

    ReplyDelete
  34. AMNESTY INDIA IS FUNDED BY FOREIGN DESH DROHIS. . ..

    WE WANT THE MODI GOVT TO TRACK DOWN THE SOURCE OF FOREIGN FUNDS....

    WE DO NOT WANT COLLEGIUM JUDICIARY TO DEAL WITH THREATS TO BHARATMATA --WE DONT TRUST THESE LAWYERS TURNED JUDGES , WHO ARE CONTROLLED FROM ABROAD . .

    WHY DOES NCM, NCW, NHRC, COLLEGIUM JUDGES, BENAMI MEDIA , RAJYA SABHA --ALWAYS SUPPORT DESH DROHIS WHO TRY TO BLEED BHARATMATA ?

    EVERY TIME OUR UNIFORMED MEN RISK THEIR LIVES AND ARREST TERRORISTS , NAXALS AND SEPARATISTS - -OUR COLLEGIUM MELORDS WHO ARE AFRAID OF JEW NOAM CHOMSKY SAVE THEM . . ..

    WE DO NOT WANT JUDICIARY TO PLAY GOD IN INDIA . .

    INDIA IS THE ONLY NATION ON THIS PLANET , WHERE COLLEGIUM JUDICIARY ELECTS JUDGES . .THEY SCUTTLED NJAC . . .

    BEFORE 1947 ALMOST ALL OUR JUDGES WERE IN THE PAYROLL OF JEW ROTHSCHILD . . .
    WE KNOW COLLEGIUM JUDGES HAVE FOREIGN SUPPORT WHEN THEIR LEGISLATE , DO EXTREME JUDICIAL OVERREACH . . . . . . .

    EVERY TIME DESH DROHI FOREIGN FORCES WANT A NEW LAW IN INDIA, THEY USE THEIR TROJAN HORSE NGOs TO FILE A PIL WHICH STRANGELY IS GIVEN TOP PRIORITY ALONG WITH HOM0SEXUALITY . . . .

    OUR COLLEGIUM JUDICIARY BURNT MIDNIGHT OIL TO OPEN CHAMIYA BARS ( WH0RE HOUSES IN MUMBAI ).....

    BREADWINNERS OF THOUSANDS OF FAMILIES HAVE BEEN AWITING JUSTICE AS UNDERTRIALS FOR DECADES . . .

    BHARATMATA IS RACING TO BE THIS PLANETS NO 1 SUPERPOWER IN 17 YEARS --BEFORE THAT THE NEW WORLD ORDER WANTS INDIA TO IMPLODE. .. . . . . . .

    ALL SEPARATIST / NAXALS / FEMINISTS / DRUGS / ATHEIST COMMIES/ UGLY IS BEAUTIFUL/ DEFYING TEACHER-PARENTS - ARE SPONSORED BY TRAITORS IN THE PAYROLL OF KOSHER FORCES . . . . .

    PM MODI CAN BE ABUSED LEFT AND RIGHT AND CALLED PSYCHOPATH --THE COLLEGIUM MELORD JUDGE SAID - - IT IS NORMAL - - - BECAUSE THERE WERE NO VIOLENT RIOTS -- . .

    The GRAVE implication is, WE COLLEGIUM JUDGES CONTROL INDIA. . . Almost all media barons run their own foreign funded NGOs and they can trigger violent riots and then get the collegium judge to ACT AND JAIL ANYBODY . . .. . .

    WHEN DID YOU LAST SEE THE BENAMI MEDIA/ COLLEGIUM JUDICIARY/ NEW WORLD ORDER CONTROLLED RAJYA SABHA SUPPORTING THE WATAN ? . .

    READ ALL 7 PARTS OF THE POST BELOW -
    punch into Google search -- -
    . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .

    capt ajit vadakayil

    ReplyDelete
    Replies
    1. British rule was the golden era in Indian History
      1. British unified over 550 princely states into a single entity.
      2. They ended Moslem domination in India and liberated Hinddus from 1000-year long subjugation that eventually led to the rise of Hinddu intellectual class who could eventually fight for the freedom of India.
      3. Britishers built excellent dams, bridges, railways, raods, etc which unheard in the rest of Asia (during 19th century).
      4. British opened many universities and colleges in India, which helped Hinddus to rise as an intellectual class.
      5. British introduced English helped India to become a software superpower in the world today.
      6. British rule considerably weakened the barbaric caste-system, even though remnants of the system remain. Even superstitions decreased to a great extent.
      7. Due to better medical services, death rate dropped and birth rate increased.
      8. British rule altogether gave a new direction to Indians who were mired in ignorance, superstitions, caste-barbarity and opened an era of modern civilization in India.

      Delete
    2. YEH LEH--

      ANGREZ KA AULAAD AAH GAYA--

      BRITIAN REDUCED INDIA FROM THE RICHEST NATION ON THE PLANET TO THE POOREST IN 250 YEARS FLAT--

      MR RISHAB FUCK OFF TO ENGLAND!

      YOU DONT BELONG TO INDIA . .

      Delete
    3. Quote 1. British unified over 550 princely states into a single entity. Unquote

      In Mahabharat (4000 BC) , Shri Krishan DECLARES - '' Whenever and wherever there is a decline in religious practice, O descendant of Bharata, and a predominant rise of irreligion – at that time I descend Myself.''(Rough Translation)

      So, which one of those princely states was named 'Bharata'?



      Delete
    4. @ Retard oh sorry Rishab

      British destruction of India

      Famines -

      “From about the beginning of the eleventh century to the end
      of the eighteenth there were 14 major famines in India.” This
      is roughly two per century. Under the period of East India
      Company rule from 1757-1858 there occurred 16 major famines,
      a rate eight times higher than what had been common
      before. Then, under the period of British Colonial Office rule
      from 1859 to 1914, there was a major famine in India an average
      of every two years, or 25 times the historical rate before
      British rule!

      The drain of wealth from India based on a tax-farming system, the destruction of native textile industry by the “free market” dumping of British textiles, and the plantation economy of opium, led eventually
      to a fierce resistance from the communal based population.

      National Income of India --

      Under Mughal rule

      India’s economy had in 1600 a 28.9% share of world
      India’s economy had in 1700 a 24.5% share of world

      Under British India National Income was

      1870 9.2% share of the world
      1913 2% share of the world

      India lost its great skills like the nano technology steel it had https://en.wikipedia.org/wiki/Wootz_steel

      The development projects like Railways were done by British for their own benefits. They cant carry Indian natural resources from jungles on elephant backs, so they needed railways for such reasons. Same with other things they did.

      Delete
    5. During British rule our nation was also destroyed and looted by the British.You(Rishab ) didn't write anything about it.Ok i accept what you said "DID THE BRITISH ALSO SENT OR LAUNCHED OUR MARS ORBITAL SATELLITE? REMEMBER IT WAS LAUNCHED BY INDIAN BRAINS(INDIAN SCIENTISTS) NOT THE BRITISH SCIENTISTS OR THE BRITISH NATION.WE INDIANS HAVE BRAINS TOO.THE BRITISHERS LOOTED OUR COUNTRY WITH THE HELP OF JEW ROTHSCHILD REMEMBER THAT AND LEARN HISTORY PROPERLY BEFORE WRITING SOMETHING".

      Delete
    6. http://ajitvadakayil.blogspot.in/2010/04/indentured-coolie-slavery-reinvented.html

      Delete
    7. GB Abhinav Kashyap, i would like to correct you, Britishers did not do any good for India but DE-Industrialized and de-developed India, stole all our Indian inventions and Technology and claimed it as their own, britishers or any White Man Do not have any morals, India was industrialized way before the so called Industrial Revolution, the so called industrial revolution started after de-industrializing India and De-developing India and stealing all our Indian Inventions and Technology

      "Indians have Brains too" LOL when did the White Man have brains?, the White Man never had brains, White Man has only stolen all our Indian inventions and technology from INDIA, We Indians are way way smarter than Whites. that is why science fields in the WEST are vigorously Dominated by INDIANS and not by White People. White People cannot calculate simple Maths in their heads how is it even possible for them to invent anything? whereas here in INDIA our 5yr old or 6yr old children calculate Maths at lightning speed.

      it is impossible for people with low intellect( White People) to invent first when compared with people with extremely High Intellect( us INDIANS )

      Truth will hurt many, let it hurt, enough is enough, enough LIES and evil fake Propaganda against INDIA.

      Delete
    8. hi Prakash I m Not anti India.I wanted to correct Rishab for what he said.Please don't mistake me.This Rishab thinks that British empire looted our Country India.BUT WHO CONTROLLED BRITISH EMPIRE IT WAS JEW ROTHSCHILD.I WANTED TO CONVEY THIS TO RISHAB.I ALSO ACCEPT WHATEVER YOU SAID THAT 'S TRUE THEY(BRITISHERS) STOLE OUR TECHNOLOGY AND EVERY VALUABLE THINGS FROM OUR COUNTRY.

      Regards

      Delete
  35. Dear Captain,
    Please accept my heart felt gratitude for your recent blogs on Patanjali. My best wishes to those here whose curiosity for knowing the limits of perceivable knowledge and beyond, are aided by the wisdom of our ancient texts and Captain's selfless narrative of the same. I pray that we all pay attention to each of our inherent karmic pursuits for this life and when the time comes, we can devote time to immerse ourselves in getting rid of our vices and start walking down the path of emancipation as far as this life takes us. Cheers!

    ReplyDelete
  36. http://timesofindia.indiatimes.com/city/hyderabad/Sports-quotas-illegal-scrap-them-Hyderabad-HC/articleshow/53748076.cms

    I HAD ONE OF MY BIHARI CADETS , WHO CAME UP BY SPORTS QUOTA

    AFTER SHAKING HIM DOWN WITH DISMISSAL FROM SEA ( NOT SHIP ) , HE ADMITTED THAT HE GOT A FAKE SPORTS CERTIFICATE FROM A MINISTER FOR HANDBALL ..

    HE NEVER PLAYED THE GAME AND HE DID NOT EVEN KNOW THE RULES OR HOW MANY PPLAYERS PLAY ON EACH SIDE . .

    ReplyDelete
  37. Pranaam Captain

    is चतुष्कोटि Hindhu or Buddhist logic ,where was it first mentioned ?

    ReplyDelete
  38. Sir,
    recent statement of M.kaju about mallus shows that he ogles this blog site regularly...:)
    Bharat Matha ki jai.

    ReplyDelete
  39. THIS BLOGSITE ASKS THE GOVT OF INDIA--

    CHARGE ALL FOREIGN FUNDED HUMAN RIGHTS ORGANISATIONS IN INDIA WITH SEDITION, WHO SUPPORT NAXALS, MAOISTS , SEPARATISTS WHO HOLD GUNS PROVIDED BY DESH DROHI FOREIGN FORCES

    NO MERCY SHOULD BE SHOWN !

    WHY IS THE COLLEGIUM JUDICIARY, NHRC, NCM SUPPORTING TRAITORS , WHO BLEED BHARATAMATA ?

    WE DO NOT WANT COLLEGIUM JUDICIARY TO DEAL WITH THREATS TO THE WATAN, INTERNAL OR EXTERNAL.

    WE DONT TRUST THESE LAWYERS TURNED JUDGES

    ReplyDelete
  40. http://timesofindia.indiatimes.com/sports/rio-2016-olympics/india-in-olympics-2016/miscellaneous/Woman-power-Karnam-Malleswari-Mary-Kom-Saina-Nehwal-and-Sakshi-Malik/articleshow/53750567.cms

    IN WEIGHT LIFTING COMPETITIONS COACHES ARE BRIBED TO MISCALCULATE THE WEIGHTS TO BE LIFTED.

    " Following her bronze, Malleswari stated that she was disappointed on missing out the gold medal. According to her, a miscalculation on the part of her coaches had seen her lift 137.5 kg in her last attempt to be gold medal contention. Even if she had lifted 132.5 kg she could have won gold; to this day, Malleswari maintains that gold was in her grasp."

    THE THING TO NOTE IS THAT KARNAM MALLESHAWARI USED TO LIFT 137.5 KGS WHILE TRAINING IN INDIA

    WE HAVE FORGOTTEN THIS BRAVE WOMEN MALLESHWARI WHO GAVE US OUR FIRST EVER OLYMPIC MEDAL

    ReplyDelete
  41. http://www.femina.in/relationships/love-sex/5-sexual-fantasies-to-spice-up-the-action-15489.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    I HAVE SEEN THIS PLANET FOR 40 YEARS

    NEVER SEEN A NATIONAL NEWSPAPER HELL BENT OF SPREADING DEBAUCHERY LIKE TOILET PAPER OF INDIA--WHO EMPLOYS ONLY MENTAL LEPERS . .

    ReplyDelete
  42. http://www.femina.in/relationships/love-sex/5-sexy-ways-to-wake-him-up-in-the-morning-17577.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA

    DIPPED IN SHIT

    ReplyDelete
  43. WHY IS A RADIOLOGIST THE DOCTOR AT RIO OLYMPICS ?

    WE WANT NEPOTISM TO BE PUNISHED BY THE SPORTS MINISTER .

    SACK BOTH THE IOA CHIEF FATHER AND THE RADIOLOGIST SON --BASTARDS !

    ReplyDelete
  44. WHY DOES THE DELHI COMMISSION OF WOMEN CHIEF STAND BEFORE A GIANT SHIRDI SAI BABA PICTURE , WHEN SHE ADDRESSES THE MEDIA ON TV ?

    WE WANT 50% REPRESENTATION OF MEN IN ANY WOMENs COMMISSION --AS MEN ARE ALWAYS AT THE RECEIVING END.

    MOST OF THE WOMEN MEMBERS OF WOMENS COMMISSIONS , ARE HORMONE DRIVEN , SUFFERING FROM PMS -- AND CANT TAKE LEVEL HEADED DECISIONS .

    WHY ARE DESH DROHI FOREIGN FORCES INVOLVED WITH NHRC, NCW AND NCM ?

    ReplyDelete
  45. I HAVE FINISHED READING MORE THAN 1600 A4 SIZE PAGES OF THE TERRIFIC FIGHT GIVEN BY THE TELUGU COMMIES AGAINST THE RAZAKARS OF NIZAM - BLOW BY BLOW EYE WITNESS ACCOUNTS .

    ALL A TERRIFIC LIE !

    EVEN TODAY INDIAN COMMUNISTS DO NOT KNOW THAT THEY SIDED WITH THE WHITE INVADER DURING THE 1942 QUIT INDIA MOVEMENT --IN WRITING. AFTER THE MOVEMENT WAS CRUSHED THE COMMIES CONGRATULATED THE QUEEN IN WRITING.

    INDIAN COMMIE TODAY DO NOT KNOW THAT THEY SIDED WITH CHINA WHEN INDIA AND CHINA HAD A WAR IN 1962.

    THE DAYS OF JNU COMMIE PROFESSORS WRITING ENDLESS BULLSHIT, PRAISING THE NAXALS ( ARMED BY ROTHSCHILD ) IS NOW OVER

    http://ajitvadakayil.blogspot.in/2013/04/razakers-of-mim-operation-polo-to-annex.html

    ReplyDelete
    Replies
    1. captain,
      enlighten us regarding comrade Bhupesh Gupta who spent a lot of time in Rajyasabha and later died in Moscow.

      Delete
  46. Murthy is Back!

    http://timesofindia.indiatimes.com/tech/tech-news/Infosys-co-founder-Narayana-Murthy-Indians-have-highest-ego-per-unit-of-achievement/articleshow/53719977.cms

    ReplyDelete
    Replies
    1. EVERYTIMENR NARAYANA URTHY OPEN HIS MOUTH, HE TRIES TO MAKE THE INDIAN SELF LOATHING

      THIS UGLY COCKEYED GUY THINKS THAT INDIA SURVIVES DUE TO HIM . .

      Delete
  47. richard williams took his two small daughters to a US tennis academy.

    These two black , unattractive girls drew sarcasm from all. because tennis was a snobbish white woman's sport

    Stung by the ridicule, Richard prophesied --

    ONE DAY THESE TWO BLACK GIRLS WILL RULE THE WORLD OF TENNIS

    unble to take the taunts, he started coaching them at home

    what is the result ?

    VENUS WILLIAMS:

    Venus Williams became the World No. 1
    Venus won seven Grand Slam singles titles
    She has 14 Grand Slam titles in women's doubles and two in mixed doubles.
    Williams won four Olympic gold medals.


    SERENA WILLIAMS

    Serena Williams became world no 1
    Serena holds the most major singles, doubles, and mixed doubles titles combined amongst active players, male or female.
    She has a total of 22 Grand Slam singles titles
    Serena won four Olympic gold medals.

    LESSON FOR INDIA: PRACTICE FROM A YOUNG AGE .

    capt ajit vadakayil
    ..

    ReplyDelete
  48. Capt., Akshay Kumar has Canadian citizenship. So all his patriot talk is farce. Another wolf in sheep's clothing?

    ReplyDelete
  49. Mr.Vadakayil, Read many of your posts. You write there was a gotra system introduced for Brahmins. Doesnt it explicitly state that Brahmins were based on birth? Why are you silent on this issue? Many post on Sanatan Dharma have passed by. Shouldnt you talk about the caste system? Wasn't it the reason for discrimination towards Karna? Do you have something to say about this? Or would you just filter my comment as one from Gora Gaand or Pickle John? Caste system has been one of the most important fundamentals of our Indian civilization. Why dont you reveal the truth about it which you already know?

    ReplyDelete
    Replies
    1. http://ajitvadakayil.blogspot.in/2012/11/gotra-system-khap-rules-y-chromosome.html

      Delete
    2. There isnt any caste system in Indian civilization. Captain has explained this in great details in past blogs. None of ancient Roman/Greek texts on India mentions about caste.

      There is only a varna system. Which is different because it is decided by your birth chart. And its main objective is tell you what kind of work is best for you take up in life.

      Think about this. Surya has a kashtriya varna. But the varna of his son shani shudra. Whiy would this happen if there was a caste system?

      Delete
    3. http://ajitvadakayil.blogspot.in/2011/07/untouchables-capt-ajit-vadakayil.html

      Delete
  50. Hi Captain,

    It seems like Congress no more cares about the opinion of people. They are hell bent on grabbing the bulk votes of Muslim vote bank by hook or crook even if it means undermining India's National Security.

    Digvijaya Singh says Kashmir is an Indian Occupied territory. This comes just after when Salman Khurshid indirectly said PoK doesn't belong to India. Mani Shankar not too long ago went for pakistan begging them to oust PM of India.

    Congress Leaders have been making such Anti-India statements recently in support of Pakistan (almost as if they are spokespersons of ISI) just after PM Modi spoke in support of PoK, Baluchistan and Gilgit Baltistan.

    ISI are using Congress leaders to express Pakistan's view and these senior Congress leaders are undermining India's National Interest.

    ####################

    Digvijay Singh terms Kashmir 'India-occupied Kashmir'

    http://economictimes.indiatimes.com/news/politics-and-nation/digvijay-singh-terms-kashmir-india-occupied-kashmir/articleshow/53753763.cms

    ####################

    One cannot understand why Hearts of Congress leaders bleeds for Pakistan and not for Hindustan. Congress party have NIL (Zero) Desh Bhakti in it. Not even one single congress leader looks like he / she truly cares for Mother India.

    As long as the party remains an Italian Occupied Congress, it will only have leaders who are corrupts, criminals, thugs, looters, scoundrels, plunderers, pseudo sickulars, selfish traitors, anti-nationals, jaichands, desh drohis who doesn't care for India but care only about themselves.

    Govt must investigate why patriot Col Purohit was tortured by Hemant Karkare and why was late ex ATS Chief Karkare was in constant touch with Digvijaya Singh ? Congress coined the word "Saffron Terrorism" and Congress have time and again tried to Bail Out Pakistan despite having concrete proof of Pakistan sponsored Terrorism in India.

    Govt must investigate why Congress is afraid of Pakistan and why ISI is controlling Congress leaders.

    It almost seems like Congress rule between 2004 - 2014 was NOT actually a Congress rule, but Pakistan was indirectly ruling India for 10 Years using Congress as proxy.

    ReplyDelete
    Replies
    1. WE CONGRATULATE ITALIAN SHERNI FOR DRIVING CONGRESS INTO THE GROUND .

      IT TAKES SPECIAL TALENT !

      Delete
  51. JAI JAI PV SINDHU

    BHARATIYA PV SINDHU

    OOPAR DEKHO PV SINDU !

    ReplyDelete
  52. http://timesofindia.indiatimes.com/city/delhi/Wont-be-silenced-or-scared-says-DCW-chief-Swati-Maliwal-after-ACBs-inquiry/articleshow/53758631.cms

    THIS WOMAN SPEAKS TO TV CAMERAS IN FRONT OF A GIANT SHIRDI SAI BABA PORTRAIT . .

    WE WANT 50% MEN IN NCW . .

    MEN ARE ALWAYS AT THE RECEIVING END . .

    NCW HAVE SAVED DESH DROHIS IN CAHOOTS WITH BENAMI MEDIA , NHRC AND COLLEGIUM JUDGES . . .

    ReplyDelete
  53. http://www.femina.in/relationships/love-sex/4-things-that-can-mess-up-masturbation-17590.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA,

    DIPPED IN SHIT !

    ReplyDelete
  54. http://www.femina.in/relationships/love-sex/have-you-ever-had-revenge-sex-17584.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA

    RUN BY MENTAL LEPERS !

    ReplyDelete
  55. Capt. One of my colleague has end stage liver cancer 11cm tumor and growing. He has consulted the best hospitals for treatments without any success. Can you suggest ayurvedic center where he could be treated. Thanks

    ReplyDelete
  56. Hi Captain,

    Wrestler Narsingh Yadav (who had a bright chance of winning Gold medal in wrestling) won't be playing at Rio Olympics and he has been banned from Olympics for 4 Years by World Anti-Doping Agency WADA.

    ####################

    NARSINGH YADAV BANNED FOR FOUR YEARS, OUT OF RIO 2016 OLYMPICS

    http://indianexpress.com/sports/rio-2016-olympics/narsingh-yadav-banned-for-four-years-by-cas-india-wrestling-wrestler-doping-dope-2984420/

    ####################

    Many feel its a Foul Play and Conspiracy by jealous west who dominates IOC and WADA who wants to retain their top 3 spots at any cost by not letting good athletes of other nations play.

    They did this foul play with Russia as well and putin was pissed off too. Pole Vaulter Yelena Isinbaeva was banned as well. Isinbaeva's speech against this Injustice almost made Putin shed tears.


    https://www.youtube.com/watch?v=v660CA_lI6k


    Corruption and Nepotism in Indian Sports Franchise has wrecked havoc on India's Olympic Dreams. Unlike Cricket which is only played by 10 nations, Olympics which is participated by almost 200 Nations needs investment, focus and support from the Government.

    China which has invested on athletes and setting up of proper infrastructure is now at 3rd place and soon they may overtake USA and UK in future Olympics while India is far behind at 71st position.

    Though BCCI has thousands of crores in its kitty, it won't spend even single paisa to develop other sports in India. If 125 Crore people of India spends just 1 rupee for 5 years (625 Crores), india will have a lot of money to develop a great sports infrastructure all over India and invest on good deserving athletes too.

    It is a shame if a nation like India with 1.25 Billion people do not manage to win even 1 single Gold Medal at Olympics. Politicians and Corrupt Bureaucrats in Sports Ministry don't seem to be interested and they don't realize what is at stake is India's Respect, Pride, Honour and Glory.

    ReplyDelete
  57. http://idrw.org/israeli-f-16-pilots-visiting-india-air-crew-exchange-program-likely-fly-sukhoi-30s/

    why is MODI allowing israel access to our SU-30mki to israeli pilots , jews will get information about our mki's avionics and give it to pakistan through their crypto jew saudi rulers . Kindly explain what is apco modi upto.

    ReplyDelete
  58. http://timesofindia.indiatimes.com/india/Amnestys-plans-for-South-Asia-hub-hit-FCRA-hurdle/articleshow/53763169.cms

    WHERE WAS AMNESTY INTERNATIONAL WHEN HINDUS WERE ETHNICALLY CLEANSED FROM PAKISTAN/ BANGLADESH/ KASHMIR AND THOUSANDS OF TEMPLES WERE DESTROYED ?

    GOVT OF INDIA MUST NOTE THAT AL JAZEERA TV CHANNEL IS SPREADING FALSE NEWS ABOUT INDIA OPPRESSING MINORITIES.

    ReplyDelete
  59. http://timesofindia.indiatimes.com/city/srinagar/Ambulance-driver-injured-in-firing-by-security-forces/articleshow/53763755.cms

    AMBULANCES ARE BEING USED TO FERRY TERRORISTS AND ARMS IN KASHMIR BY PAKISTANI OUTFITS

    ReplyDelete
  60. http://www.femina.in/relationships/love-sex/sexy-slang-terms-to-know-17874.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA

    RUN BY MENTAL LEPERS!

    ReplyDelete
  61. http://www.femina.in/relationships/love-sex/5-body-language-cues-that-lead-to-sex-14280.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    TOILET PAPER OF INDIA

    DIPPED IN SHIT

    ReplyDelete
    Replies
    1. i observed and i know you have observed that too that these post are mostly by those 2 girls Nikita Sawant & Namrata D'souza...i guess they themselves need some basic moral education...And you are one who can give that

      Delete
  62. Namastey captain
    Now another sc judgement of mumbai against Hinduism ritual dahi handi.
    Its serious to democracy and interfering in unconstitutional sections.

    ReplyDelete
  63. Captainy, i hve been recenlty been confirmed to have chron's disease. Im the first person to have this disease. Do you suggest anything to cure or push this disease in to remission. Thank you captain

    ReplyDelete
    Replies
    1. hi dk,

      become vegan

      consume virgin coconut oil and fresh turmeric in your diet

      eat only freshly cooked food.

      keep away from GM foods, processed foods, and milk of humpless jersey cow.

      http://ajitvadakayil.blogspot.in/2013/08/probiotics-prebiotics-friendly-gut.html

      http://ajitvadakayil.blogspot.in/2014/10/no-farting-please-capt-ajit-vadakayil.html

      Delete
  64. See page 15 of Toilet Paper today - full of Dalit uprising news! Looks like Toilet Paper wants to stage a revolution by dividing Hindus! It is high time this paper is brought to book!

    ReplyDelete
    Replies
    1. TODAY ALL BR AMBEDKAR/ EVR PERIYAR STUDENTS UNIONS ARE CONTROLLED FROM ABROAD

      Delete
    2. @ Gama pada only way to stop this hopeless paper and its knowledge is stop buying this paper..that will bought this paper to history

      Delete
  65. Sir,

    As always, am grateful to you for educating us with truth through your eye opener blogs.

    My 5 yr old has a weak eyesight. Doctos are recommending wearing glasses. Are there any proven home or natural remedies that can help her gain her normal 20/20 vision back?

    Thank you so much

    ReplyDelete
  66. Sir,

    As always, am grateful to you for educating us with truth through your eye opener blogs.

    My 5 yr old has a weak eyesight. Doctos are recommending wearing glasses. Are there any proven home or natural remedies that can help her gain her normal 20/20 vision back?

    Thank you so much

    ReplyDelete
    Replies
    1. http://ajitvadakayil.blogspot.in/2011/11/seeing-without-glasses-capt-ajit.html

      Delete
    2. Thank you so much Captain. You responded so quickly. Unbelievable. Last time you had suggested some remedies for weak teeth and gums, I followed and it has helped immensely. I trust your blogs and advice more than any other knowledge resource on internet.

      Delete
  67. We ask the indian govt to throw all "ANJEM CHOUDARYs " of india into jail.

    Anjem Choudary is a pakistani ( salafi/ wahabi ) who is now getting screwed by the englishman

    For 20 years Anjem Choudary stood on street corners, in shopping precincts, outside mosques, embassies and police stations and used his megaphone to drive a wedge between Muslims and the rest of Britain.


    Like India's rabid Salafi preacher Zakri Nail, Anjem Choudary's mindset is really simple. There are two worlds - the world of belief, meaning Muslims, and the world of disbelief, everyone else.

    Like Zakri Naik Anjem Choudary proclaimed a single Islamic state, under Sharia, for the whole world, for all areas of life.

    Rosthchild run BBC always gave Anjem Choudary a platform for his views.

    WHY ?

    NOT MANY PAKISTANIS KNOW THAT ANJEM CHOUDARY IS A CRYPTO JEW. HE DRINKS ALCOHOL ON THE QUIET.

    Abu Rumaysah ( Siddharta Dhar ) worked as an aide to Anjem Choudary. Like Zakir Naik Dhar declared " I am Muslim first, second and last"

    Siddhartha Dhar, is called the “New Jihadi John”. Dhar, had skipped police bail in the United Kingdom to travel to Syria with his wife and young children in 2014.

    Hullo- STUPID John Bulls -- why dont you find out how Dhar, a marked man , found it so easy to travel to Syria.

    ISIS WAS CREATED , FUNDED AND ARMED BY JEWS.

    How many of you heard of crypto Jew Ganga Dhar ( Ghiyazuddin Ghazi ) ?

    ReplyDelete
  68. https://www.youtube.com/watch?v=gW8kzs9Oca4

    USAIN BOLT, THE GREATEST HERO OF THE SPORTING WORLD

    THREE TRIPLES ( 100 /200 / 4 X 100 METRES ) --

    Nine golds for Usain Bolt , in a sport where just one GOLD MEDAL is a great lifetime achievement.

    Bolt surged down the track anchoring the race , like he has done so many times before, powering his way into sporting history — and further into greatness nay immortality

    YIKES !

    ReplyDelete
  69. Dear Sir,

    Is it good to have a tablespoon of organic apple cider vinegar in 8oz of water first thing in the morning?

    Thanks,
    BS

    ReplyDelete
  70. THIS BLOGSITE LAUDS RUSSIAN WOMAN POLE VAULTER YELENA ISINBAYEVA .

    THE WHOLE OF THE RUSSIAN TRACK AND FIELD ATHLETICS TEAM WAS BANNED FROM RIO.

    WE ALL KNOW THAT RUSSIAN ATHLETES HAVE LESS CHEMICAL IN THEIR BODIES COMPARED TO USA, UK AND OTHER WESTERN NATIONS

    WITHOUT HER PRESENCE THE POLE VAULT GOLD FOR WOMEN AT RIO IS A SHIT GOLD MEDAL TO WIN-- WHERE EVER IT IS DISPLAYED IT WILL STINK.

    YELENA ISINBAYEVA IS A TWO TIME OLYMPIC GOLD MEDALIST .

    LIKE USAIN BOLT SHE COULD HAVE WON A THIRD GOLD MEDAL -- 100% --THE WHOLE WORLD KNOWS THIS. SHE HAD DELIVERED A BABY RECENTLY.

    She is a three-time World Champion, the current world record holder in the event ( 5.06 metres ) , who is THE greatest female pole-vaulter of all time

    She became the first woman to clear the five-metre barrier in 2005.

    this great heroine was punished by the zionist jew lobby because she told on TV that she favours a law banning "homosexual propaganda" in Russia.

    Isinbayeva had made her remark in response to several western athletes who pasted false finger nails showing the gay rainbow-- in support for gays and lesbians in Russia .

    THE BAN ON RUSSIA SHOWED THE EAGERNESS OF IAAF TO PROMOTE PEDOPHILIA, -- THE RIGHT OF AN ADULT TO ABUSE SMALL CHILDREN , THE RIGHT OF A MAN TO SHOVE HIS PRICK INTO THE ASSHOLE OF A SMALL INNOCENT BOY .

    IS ANY HOMOSEXUAL DOES NOT AGREE, --

    PLEASE SUBMIT TO A NARCO TRUTH SERUM TEST, SO THAT WE CAN FIND OUT AT WHAT AGE HE/ SHE INITIATED PEDOPHILIA ( ALONG WITH NUMBER OF TIMES ) AND AT WHAT AGE HE/ SHE WAS INITIATED .

    capt ajit vadakayil
    ..

    ReplyDelete
  71. KASHMIRIS WHO HOLD GUNS AND GRENADES PROVIDED BY PAKISTAN ARE NOT INDIAN CITIZENS- AND THEY MUST NOT BE TREATED LIKE THE REST OF THE INDIAN CITIZENS .

    THE INDIAN CONSTITUTION DOES NOT PROTECT PEOPLE WHO WAGE WAR AGAINST THE WATAN.

    ANYBODY WHO ARGUES ON THE TRUTH OF THE ABOVE SENTENCE ARE THEMSELVES DESH DROHIS ..EVEN IF HE IS THE PRESIDENT OF INDIA.

    capt ajit vadakayil
    ..

    ReplyDelete
  72. pv sindhu is raking in the moolah as rich rewards for her silver medal.

    THE INDIAN GOVT MUST KNOW THAT DIPA KARMAKAR AND HER COACH HAS MADE INDIA MORE PROUD !

    DIPA AND HER COACH MUST BE REWARDED WITH MONEY .

    ReplyDelete
  73. Captain, Nityananda talks about Sastanga yoga (shaktis or oneness) and they have better architecture than Patanjali siddhis. Can you please put a post on them ..https://www.youtube.com/watch?v=Tvsu9Xb93So from 42nd minute

    ReplyDelete
  74. Hello Sir, Have you seen this news?

    quote

    Modi invites Prachanda to visit India

    Mr. Modi conveyed this to Bimalendra Nidhi, Deputy Prime Minister and Minister of Home Affairs of Nepal, when he called on him in the Capital on Saturday.

    Prime Minister Narendra Modi on Saturday extended an invitation to new Prime Minister of Nepal Pushpa Kamal Dahal ‘Prachanda’ to visit India at the earliest while expressing commitment to strengthening traditional bonds of friendship and kinship.

    Mr. Modi conveyed this to Bimalendra Nidhi, Deputy Prime Minister and Minister of Home Affairs of Nepal, when he called on him here.

    During the meeting, Mr. Modi conveyed his greetings and best wishes to the new government of Nepal led by Prachanda and extended an invitation to him to visit India at his earliest convenience, a PMO statement said.

    Mr. Nidhi briefed the Prime Minister about developments in Nepal where the new government took over recently.

    Mr. Modi said the relations between India and Nepal were not merely between the two governments but between the people of the two countries and that India is committed to strengthening these traditional bonds of friendship and kinship with the people of Nepal.

    The Prime Minister also said that India is fully committed to support the government and the people of Nepal in the post-earthquake reconstruction efforts.

    Relations between India and Nepal went through a bad phase last year and the two countries are hoping to make a new beginning after the new government took over in Kathmandu.

    unquote

    http://www.thehindu.com/news/national/nepals-special-envoy-calls-on-modi/article9011688.ece

    ReplyDelete
  75. Namaskar captain Ajitji....
    Recently a christian asked me .......homosexuality is accepted in vedic scriptures......there are cross dressers too......what to answer them..

    ReplyDelete
    Replies
    1. THIS IS THE THIRD TEMPLATE OF SANATANA DHARMA ABOUT PURUSHA / PRAKRITI

      THIS IS BEYOND SHALLOW CHRISTIAN MINDS

      http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html

      Delete
  76. BAN AMNESTY INTERNATIONAL IN INDIA

    WE DO NOT WANT FOREIGN FUNDED DESH DROHI ORGANISATIONS SAVING NAXALITES , SEPARATISTS AND TERRORISTS IN INDIA.

    THE INDIAN CONSTITUTION CANNOT BE APPLIED ON TRAITORS WHO HOLD FOREIGN GUNS , TO BREAK UP THE WATAN.

    AMNESTY INTERNATIONAL HAS NEVER SAID A WORD ABOUT THOUSANDS OF HINDU TEMPLES DESTROYED IN KASHMIR, PAKISTAN AND BANGLADESH . THEY HAVE NEVER SAID A WORD ABOUT ETHNIC CLEANING OF HINDUS .

    WE DO NOT WANT COLLEGIUM JUDICIARY, NHRC, NCW, NCM , CONTROLLED BY FOREIGN FORCES TO SAVE INDIA

    WE KNOW THE TRAITORS OF INDIA , WE KNOW WHO FUNDS THEM

    ALL IN GOOD TIME

    ReplyDelete
  77. ONE DAY MY RUSSIAN CHIEF OFFICER ( FROM MURMANSK ) SHOWED ME PICTURES AND VIDEOS OF HIS 4 YEAR OLD DAUGHTER IN A RUSSIAN GYMNASTICS ACADEMY.

    THE GIRL LOOKED LIKE A BARBIE DOLL AND SHE WAS HAPPY IN EVERY FRAME.

    THEN I SHOWED HIM A FEW PICTURES AND VIDEOS ON MY LAPTOP WHEN YOUNG CHINESE GIRLS WERE CRYING WHILE DOING THEIR ROUTINES

    HE SAID --IN RUSSIA WE DONT ALLOW THE JOY OF SPORT TO BE CRUSHED

    YESTERDAY ON TV I SAW LOT OF SMALL 3 AND 4 YEAR OLD INDIAN GIRLS HOLDING DIPA KARMAKARS HAND .

    I COULD NOT HELP BUT SMILE WRYLY

    DIPA KARMAKAR HERSELF SAID , THAT SHE DID MORE THAN 1000 PRODUNOVA VAULTS IN THE FEW MONTHS LEADING TO RIO OLYMPICS

    I DO HOPE PEOPLE RECOGNISE THE PAIN SHE WENT THROUGH

    HATS OFF TO HER COACH, WHO WAS NOT A GYMNAST HIMSELF -- WHO KNEW SHIT ABOUT GYMNASTICS-- BUT STILL PRODUCED A WORLD CLASS DIPA KARMAKAR

    THIS MAN NANDI DESERVES TO BE HONORED .

    http://sports.ndtv.com/olympics-2016/news/262076-dipa-karmakar-did-1000-death-vaults-before-rio-2016-coach-reveals-to-ndtv

    GOD BLESS DIPA KARMAKAR - I WISH I HAD HALF HER HUMILITY

    ReplyDelete
    Replies
    1. http://www.chinasmack.com/2012/pictures/chinese-gymnastics-kids-training-with-tears-sweat-dreams.html

      https://tvaraj.com/2012/12/18/chinese-coaches-torture-kids-to-create-olympic-champions/

      Delete
  78. http://timesofindia.indiatimes.com/india/Coup-mastermind-Gulens-organisation-has-infiltrated-India-Turkey/articleshow/53795301.cms

    WE DONT WANT CRYPTO JEW ERDOGAN TO PUT INDIA INTO FOG

    TURKEY HAS BEEN RULED BY CRYPTO JEWS EVER SINCE THE SULTAN WAS OUSTED BY ROTHSCHILD.

    Mustafa Kemal Atatürk was a JEW ( mind you, he is justice markendey katju's hero )

    read all 5 parts of the post below--

    http://ajitvadakayil.blogspot.in/2015/04/lawrence-of-arabia-truth-exhumed-capt.html

    if india has to be a superpower we must know world intrigue.

    ReplyDelete
  79. Respected sir, i thank you again for enlightening us all with the correct understanding of sanatan dharma and so many more topics.
    A question about naga sadhus and other sadhus who take sanyas in youth and breaking bonds of family and avoiding marriage. You have said marriage is mandatory and all historic sages were married and only an exceptional pledge allows you to skip marriage. Then sir are all these naga and other sadhus (who roam about across jungles and villages ) misguided? Please forgive if i misunderstood something.

    ReplyDelete
    Replies
    1. WHEN ISLAMIC INVADERS WERE CONVERTING HINDUS BY SWORD " CONVERT OR DIE"

      A SECT OF HINDU SAGES , STARTED "MILITANT HINDUSIM"

      THEY SWORE NOT TO MARRY AND HOLD PROPERTY -- AS FAMILY TIES YOU DOWN

      THIS IS A MASSIVE PERSONAL SACRIFICE.

      TODAY YOU SEE THEM AT KUMBH MELA

      http://ajitvadakayil.blogspot.in/2013/02/kumbh-mela-mother-of-all-pilgrimages.html

      TODAY THESE SADHUS ARE DENIGRATED BY COMMIE HISTORIANS

      http://ajitvadakayil.blogspot.in/2014/09/aghoris-corpse-eaters-of-india-capt.html

      Delete
  80. peeyush baj
    August 23, 2016 at 3:15 AM

    dear captain.. namaste.

    Sir how do you so confidently say that we will be number 1 superpower in 17 years.. whats the rationale??/ plz elaborate.. you havent written a blog post on this.. on India's potential to be a world leader?
    Regards

    ReplyDelete
    Replies

    Capt. Ajit Vadakayil
    August 23, 2016 at 6:21 AM


    ###########.. SUBJECT --- ROARING LION OR ONE EYED CAT . . ###########

    The Economy of India is the THIRD largest economy in the world measured by nominal GDP and the third-largest by purchasing power parity (PPP).

    We know what the G7 nations are worth . .

    India's economy is the world's fastest growing major economy…

    In another 17 years India will be planets no 1 superpower . .

    India is home to world's third largest Billionaires pool with 111 billionaires in 2016 and also the largest number of ultra-high-net-worth households that have more than 100 million dollars…

    RAGHURAM RAJAN DOES NOT UNDERSTAND ECONOMICS . . . INDIA IS BEING DELIBERATELY PROJECTED AS A ECONOMICALLY WEAK NATION . . .

    INDIAS ECONOMIC GROWTH CAN READ A STUPENDOUS 11.5% IF WE FACTOR IN SMALL SCALE AND ULTRA SKILLED FAMILY BASED INDUSTRIES IN GDP . .

    RAGHURAM RAJAN WANTS USA TO BE NO 1 . . .

    INDIA IS A ROARING LION IN THE WORLD ECONOMY-- THE ONLY ONE . .

    RAGHURAM RAJAN TRIED HIS BEST TO PROJECT THIS MIGHTY WOKEN UP LION AS A DISEASED ONE EYED CAT . . . FOR THIS HE MUST BE PUNISHED .. .IT IS NOT ENOUGH THAT WE JUST LET HIM GO . .

    RAGHURAM RAJAN NEVER TOLD EVEN ONCE THAT USA HAS 19.4 TRILLION USD EXTERNAL DEBT .. ..

    RAGHURAM RAJAN NEVER TOLD EVEN ONCE THAT CHINA IS A PONZI ECONOMY . . ..

    Chinas borrowings hit 30.1 trillion USD at the end of last year, equivalent to 291 % of the chinese economys GDP. In the non-financial corporate sector, the debt-to-GDP ratio is estimated at 161 %.. ..all the G7 nations are beggar nations, whose debts can NEVER EVER be repaid without WW3 . ..

    China’s GDP growth is just 4.3% and NOT their official figure of 6.8%.
    Instead of tackling a debt pile estimated at 2.5 times the economy’s size, policy makers are only making it worse with a renewed credit binge.

    China continued to ignore their pathetic problem of BUBBLES WITHIN BUBBLES that drives the misallocation economy in China, or keep injecting massive credit flows into an already overblown economy in an attempt to delay the inevitable collapse.

    Chinese economy is being managed by MAD men who are keen to avoid loss of face . China’s ruling Community Party faces a dilemma between the urgent need to transform the country’s slowing economy, and the possibility of losing control and social unrest if massive layoffs happen.

    Japan’s level of government debt: the ratio of gross debt to GDP is 252% .. .

    http://ajitvadakayil.blogspot.in/2016/06/gpi-dog-shall-wag-gdp-tail-not-vice.html

    Capt ajit vadakayil
    ..

    ReplyDelete
  81. Veena N
    August 23, 2016 at 9:51 AM

    Dearest Captain
    In Kerala we dont celebrate Raksha Bandhan.
    But now the Rss is bringing the ritual of tieing Rakhee. Kindly do explain captain.

    Pranam
    Dr. Veena J.Nair

    ReplyDelete
    Replies

    ###########################

    Capt. Ajit Vadakayil
    August 23, 2016 at 1:02 PM
    hi vn,

    IN KERALA WE DONT CELEBRATE RAKSHA BANDHAN

    after king bali was shoved off to patala by vishnu -- vishnu developed remorse and went to patala where he stayed as a guest of bali

    vishnu wife lakshmi disguised herself as a brahmin woman and tied a sacred thread around king bali, declaring him as her brother --

    bali asked her what her wish is--and then he coaxed vishnu to go back to vaikunta

    The event initiated the custom of sister’s trying Rakhi on the day of Shravana Purnima.

    http://ajitvadakayil.blogspot.in/2011/09/why-kerala-does-not-celebrate-diwali-or.html

    2300 years ago alexander the great took an indian wife roxanna , to know the secrets of the hindu kush pass.

    the greek army was routed by king porus. the elephants and the tibetan mastiff dogs psyched the greek horses. the greek army saw indian sages in deep meditation covered by cobras and they were afraid.

    when alexander was mortally wounded roxanna ran to porus and tied a rakhi around his wrist and made him her brother.

    http://ajitvadakayil.blogspot.in/2010/05/alexander-great-and-king-porus-hidden.html

    http://ajitvadakayil.blogspot.in/2010/04/wwho-let-dogs-out-capt-ajit-vadakayil.html

    capt ajit vadakayil
    ..

    ReplyDelete
  82. DOES THIS TRAITOR ACTRESS RAMYA KNOW --

    HOW MANY HUNDREDS OF HINDU TEMPLES WERE DEMOLISHED FROM 1947 TO 2016 IN PAKISTAN ?

    DOES THE KNOW THE PERCENTAGE OF ETHNIC CLEANING OF HINDUS FROM 1947 TO 1916?

    DOES RAMYA KNOW HOW MANY INDIAN JAWANS WERE KILLED BY PAKISTANIS ?

    THE ENTIRE BENAMI MEDIA IS SUPPORTING THIS TRAITOR ACTRESS RAMYA....

    WHEN RAJNATH SINGH WENT TO PAKISTAN FOR SAARC , THE PAKISTANIS BLOCKED THE VIEW OF INDIAN MEDIA BY STRONG ARM TACTICS ...

    HOME MINISTER RAJNATH SINGH WAS DISRESPECTED...

    ReplyDelete
  83. Capt., What was the time of the day Lord Krishna was born? Couldn't find it. Some say he was born at midnight?

    ReplyDelete
  84. sir went to visit your elder son ?

    ReplyDelete
  85. Hi Captain.
    Please pen down an article on Tamil Bhramins ( dont mix Iyers and Iyengars ) . Write about Tambrahms right from the time of Sage Agastya.

    There are many accusations made by you against them like for eg Sucking up to the British to make Tamil the oldest language.

    But you should know that Iyers both Shivite and Srauta-Smartha subsects follow the Sanskrit scriptures.

    It is the Iyengars ( Thenkalai make 80℅ of Iyengars who are non Bhramin stock genetically ) who revere the Tamil Divya prabdhanam.
    So it is possible that it was their handy work to date Tamil as the oldest language.

    It is unimaginable that you always mention the bad about this community and not the good. And also put blame of the bad work done by the Tamil Iyengars on the Tamil Iyers.

    I am sure you know many Vadama iyers live in Kerala who came from Thirunalveli and Tanjavur.
    Uddana Shastri is also believed to be a Vadama Iyer who won the Revathi pattadhanam at your hometown Calicut.

    Also I would like to point out after reading your post on "Namboodiris the worst racist on the planet".

    That they are not the only Bhramins to have a left frontal lopsided min kudumi.
    Chidambaram Dikshitar sub group of Shivite Tamil Bhramin also sport the same hairstyle. But I have seen that you have mentioned that Namboodiris are the only Bhramin group in this planet to do so.

    The Sholiyar Iyer ( a sub group of Smartha Iyers ) also have a mun kudumi. The sholiyars Iyers too believe that Chanakya was one of Them.
    Many stauch Iyers have a seal of their caste mark on their right shoulder. Like a farmer marks his cows using hot iron.

    Please write a post on Tamil bhramins. I know you hate them but you have downplayed many of their contributons . You only talk about them post 1850 CE. Only 10 ℅ of them were British govt servants the rest had aversion to the British. And that 10℅ had taken 70℅ of British jobs.
    And these were the same Bhramin who revolted against the British in 1857 in Madras .

    Also
    >>
    I have heard from many malayalees that the Namboodiris were initially thiyyas or other lower caste , but later got initiated to Bhraminhood as there were no Bhramins in Kerala when Lord Parasuram came to Kerala.
    As there were no Bhramins willing to come to Kerala as Lord Parashuram had the sin on him . To remove his sin he wanted to gift land to Bhramins. So as no bhramins in neighboring Tamil country were willing to go to the newly created land, the locals were initiated into Bhramin hood and taught the Tantram form of worship.
    <<

    Most importantly write separately about Iyengars and the Thenkalai group particularly.

    I went through this site of the Srivaishnavam.
    It openly bashes Adi Shankara and looks down upon Afvaitins.
    www.srivaishnavam.com/faq.html

    It says that only followers of Srivaishnavam sampardaya get moksham.

    Hoping for a long reply and then a longer blog. UNbiased which doesn't start in 1800s and British jobs.


    ReplyDelete
    Replies
    1. Capt ji pls respond to my message above

      Delete
  86. WARNING:

    THIS BLOGSITE WARNS ARNAB GOSWAMI, THE TV ANCHOR OF TIMESNOW TV - -

    YOU SHALL STOP YOUR SLIMY ANTI-WATAN AND ANTI-HINDU PROPAGANDA IMMEDIATELY ..

    YESTERDAY THIS MORON WAS EQUATING "MENSTRUATING WOMEN ENTERING SABARIMALA TEMPLE" WITH "SATI "

    SABARIMALA IS THE WORLD LARGEST PILGRIMAGE, AND THE ONLY REAL PILGRIMAGE WHICH DOES GOOD TO THE PILGRIM . . BECAUSE OF THE AUSTERE VRAT FOR 41 DAYS .

    http://ajitvadakayil.blogspot.in/2013/01/sabarimala-makaravilakku-three-light.html

    WE INDIANS NEVER HEARD OF THE TERM "SATI" TILL THE WHITE INVADER CAME TO INDIA . .

    NO PURANA STORY EVER TALKS ABOUT A WIDOW JUMPING INTO HER HUSBAND PYRE.

    IN THE CASE OF SHIVA WIFE SATI--SHE SELF IMMOLATED.

    http://ajitvadakayil.blogspot.in/2013/02/vedic-hindu-fire-temple-of-baku.html

    EXCEPT VISHNU AVATARS ( RAM , KRISHNA ETC ) , ALL HINDU GODS AND THEIR WIVES ARE AMAZING COSMIC ALLEGORIES.

    HINDU WOMEN JUMPING INTO THE FORE STARTED ONLY WHEN ISLAMIC INVADER SOLDIERS STARTED RAPING DEAD WOMENs BODIES.

    SO THE WOMEN ( WHOSE HUSBANDS DIES IN BATTLE ) JUMPED INTO THE FIRE ENMASSE --AS PRACTISE CALLED JAUHAR.

    THIS IS EVEN TODAY BEING DONE BY "LIVE" SLAVE YAZIDI WOMEN , TO FUSE THEIR GENITALS AND DISFIGURE THEIR FACES.

    http://www.independent.co.uk/news/world/middle-east/isis-soldiers-rape-yazidi-girl-sets-herself-on-fire-burns-alive-iraq-refugee-camp-a7208656.html

    YAZIDIS ARE ANCIENT HINDUS

    THIS BLOGSITE WAS THE FIRST TO REVEAL IT AND IMMEDIATELY THE NO 1 OPPORTUNIST SRI SRI RAVISHANKAR RAN THERE TO GRAB FAYADA. LIKE HOW HE WENT TO MEET BURHAN WANIs FATHER TO GRAB THE LIMELIGHT AND FAAYADA.

    HOMOSEXUALITY AND HYPERVENTILATION FAKE YOGA PUSHING SRI SRI RAVISHANKAR DOES NOT REPRESENT INDIA OR HINDUS . THIS BLOGSITE SAYS SO.

    ARNAB GOSWAMI I KNOW YOU WILL READ THIS-- I HAVE MULTIPLE SOURCES AMONG TIMESNOW TV STAFF - -

    YOU SHALL STOP GIVING A PLATFORM TO DESH DROHI PAKISTANIS ( THE WAY YOUR KOSHER BOSSES WANT ) , SEPARATISTS, NAXALITES AND RABID ANTI-HINDU PERCEPTION MOLDERS

    punch into WORST JOURNALIST mr arnab goswami-- what do you see?

    my post about anti-hindu anti-watan NON-FADING VIOLET is no 1 among 35 million posts .

    i will give YOU the most dubious honor ever -- the worst legacy ever for a journalist --just ignore this warning and you shall see ---.

    ENOUGH IS ENOUGH - FISH MARKET JOURNALISM !!

    AAARGGHHH PPTTHHEEEOOOYYYYYYYY !

    capt ajit vadakayil
    ..

    ReplyDelete

  87. SOMEONE ASKED ME TO CLARIFY ABOUT HINDU GODS --

    EVERY HINDU GOD SHIVA, VISHNU, PARVATI, LAXMI, GANAPATI etc ARE COSMIC FORCES OF ENERGY . .

    WE HAD 4 VARNAS

    BRAHMINS CONVEYED THE VOLUMINOUS VEDAS FOR 300 CENTURIES WITHOUT LOSING A SYLLABLE .. BEFORE THEY WERE PENNED DOWN 70 CENTURIES AGO . .

    HUMAN DNA WAS DEGRADING AND SUCH MEMORY FEATS WERE GETTING HARD TO GET . .

    http://ajitvadakayil.blogspot.in/2011/07/untouchables-capt-ajit-vadakayil.html

    THE BOTTOM THREE VARNAS HAD TO BE CONTENT WITH PURANAS-- OUR GODS WERE PERSONALISED FOR EASY CONSUMPTION AND RETENTION , AMONG THE ILLITERATE AND NOT SO BRIGHT . .

    FOR EXAMPLE: OPERATON DESERT STORM , WAS NOT FOUGHT IN A DESERT STORM. IT IS JUST AN EASY WAY TO REMEMBER . .

    SO THERE IS NO FUCKIN' WAY--

    ######## BRAHMA CAN SCREW HIS OWN DAUGHTER

    ####### SHIVA CAN FUCK THE WIVES OF THE SAPT RISHIS ( GREAT SIPPER STARS ) WHO WERE IN DEEP PENANCE

    #### SHIVA CAN EAT CORPSES OR RAPE NANDI BULL ANALLY

    ##### VISHNU CAN SCREW SHIVAs WIFE BEHIND HIS BACK

    ###### SHIVA AND VISHNU CAN HAVE HOMOSEXUAL ANAL SEX AND PRODUCE LORD AYYAPPA ( NINTH AVATAR OF VISHNU )

    DROHI --ROGUE SRI SRI RAVISHAKAR HAS THE FOLLOWING TO SAY ABOUT SHIVA AND VISHNU PRODUCING A CHILD BY GAY SEX . .

    AND THIS SHAKTI MAGIC OIL PEDDLING DROHI ( WITH A DYED BEARD AND GARGANTUAN PAUNCH ) CLAIMS TO REPRESENT SANATANA DHARMA AS PER ROTHSCHILDs MEDIA . .

    https://twitter.com/srisri/status/410810667176697856?lang=en

    VISHNU AVATARS LIKE RAM, KRISHNA , AYYAPPA WERE MORTALS WHO LIVES ON EARTH WITH 13 STRAND DNA ( NIL JUNK ) AND MORE.

    BRAHMAN , THE MOTHER FIELD , SHEARED OFF PARTS OF ITSELF , AND SEND THEM ON EARTH WITHOUT REDUCING THE SOUL FREQUENCY .

    YOU AND ME WERE SENT DOWN ON EARTH BY REDUCING SOUL FREQUENCY AND WE ( SOULS ) HAD TO EVOLVE TILL WE GOT MOKSHA ( SOULD NOT HACE HIGHEST FREQUENCY ) AND MERGED BACK WITH THE MOTHER BRAHMAN FIELD ON THE 7TH ASTRAL KAYER

    ONLY VISHNU CAN HAVE AVATARS .

    THIS IS BECAUSE VISHNU CONTROLS THE SECOND TEMPLATE OF DVAITA

    VISHNU MEDIATES THE DANCE OF OPPOSITE FORCES ( SHIVA/ BRAHMA -- SAY CONDENSATION/ EVAPORATION )

    http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html

    JUST IN CASE SHIVA FOLLOWERS GET UPSET THAT VISHNU FOLLOWERS HAVE STOLEN A MARCH OVER THEM - -

    CONSIDER THIS--

    THE THIRD TEMPLATE ( SUPER IMPOSED ON BASE BRAHMAN ) OF SANKHYA CONSISTS OF SHIVA AND HIS WIFE SHAKTI ( PARVATI/ DURGA/ KALI )

    YOU CANNOT HAVE SHIVA WITHOUT VISHNU AND BRAHMA

    YOU CANNOT HAVE SHIVA WITHOUT HIS WIFE PARVATI . . THIS CONCEPT CALLED ADHANEESHWARA DOES NOT MEAN THAT SHIVA IS A TRANGENDER HIJRA AS TOM TOMMED BY BR AMBADKAR, EVR PERIYAR, MAHATMA PHULE, UR ANATHAMURTHY, KALBURGI, PANSARE , DHABHOLKAR etc

    NEPAL WAS A HINDU NATION . .

    ROTHSCHILD COMMIES CONVERTED NEPAL INTO A COMMIE NATION AND GOT THE ROYALTY ELIMINATED

    HOW DID COMMUNISM RISE SO FAST IN NEPAL?

    THEY MADE THE HINDUS SELF LOATHING AND MADE THEM ATHEISTS.

    THE ANNUAL GHADHIMAI ANIMAL SACRIFICE MASSACRE WAS PART OF THIS BRAINWASH.

    THIS BLOGSITE CLAIMS CREDIT FOR STOPPING THIS ANNUAL HORRIBLE ANIMAL MASSACRE . .

    http://ajitvadakayil.blogspot.in/2014/11/all-animal-sacrifices-in-hindu-temples.html

    JNU COMMIE PROFESSORS CREATED A COMMIE NEPAL PRIME MINISTER NAMED BABURAM BHATTARAI- WHO WAS INVOLVED IN THE WESTERN SPONSORED NEPAL ROYAL MASSACRE

    AND WHAT DOES OUR APCO MODI DO?

    HE GOES TO ASSAM AND PROPS UP THE HUMAN/ ANIMAL SACRIFICING KAMAKHYA TEMPLE ( ROTHSCHILDs CREATION ) --JUST TO MILK VOTES. .

    http://www.narendramodi.in/pm-modi-offers-prayers-at-kamakhya-temple-in-assam-440177

    WHEN DID MODI LAST SUPPORT A CAUSE FOR HINDUS? . .

    HE BEGGED AND SECURED HINDU VOTES--

    ENSCONSED HIMSELF ON THE PMs CHAIR AND THEN KICKED THE HINDUS ON THEIR COLLECTIVE TEETH ..

    SUCH IS HIS GRATITUDE . INGRATITUDE IS THE GREATEST OF ALL HUMAN VICES .

    capt ajit vadakayil
    ..

    ReplyDelete
    Replies
    1. Hi Captain.
      Please pen down an article on Tamil Bhramins ( dont mix Iyers and Iyengars ) . Write about Tambrahms right from the time of Sage Agastya.

      There are many accusations made by you against them like for eg Sucking up to the British to make Tamil the oldest language.

      But you should know that Iyers both Shivite and Srauta-Smartha subsects follow the Sanskrit scriptures.

      It is the Iyengars ( Thenkalai make 80℅ of Iyengars who are non Bhramin stock genetically ) who revere the Tamil Divya prabdhanam.
      So it is possible that it was their handy work to date Tamil as the oldest language.

      It is unimaginable that you always mention the bad about this community and not the good. And also put blame of the bad work done by the Tamil Iyengars on the Tamil Iyers.

      I am sure you know many Vadama iyers live in Kerala who came from Thirunalveli and Tanjavur.
      Uddana Shastri is also believed to be a Vadama Iyer who won the Revathi pattadhanam at your hometown Calicut.

      Also I would like to point out after reading your post on "Namboodiris the worst racist on the planet".

      That they are not the only Bhramins to have a left frontal lopsided min kudumi.
      Chidambaram Dikshitar sub group of Shivite Tamil Bhramin also sport the same hairstyle. But I have seen that you have mentioned that Namboodiris are the only Bhramin group in this planet to do so.

      The Sholiyar Iyer ( a sub group of Smartha Iyers ) also have a mun kudumi. The sholiyars Iyers too believe that Chanakya was one of Them.
      Many stauch Iyers have a seal of their caste mark on their right shoulder. Like a farmer marks his cows using hot iron.

      Please write a post on Tamil bhramins. I know you hate them but you have downplayed many of their contributons . You only talk about them post 1850 CE. Only 10 ℅ of them were British govt servants the rest had aversion to the British. And that 10℅ had taken 70℅ of British jobs.
      And these were the same Bhramin who revolted against the British in 1857 in Madras .

      Also
      >>
      I have heard from many malayalees that the Namboodiris were initially thiyyas or other lower caste , but later got initiated to Bhraminhood as there were no Bhramins in Kerala when Lord Parasuram came to Kerala.
      As there were no Bhramins willing to come to Kerala as Lord Parashuram had the sin on him . To remove his sin he wanted to gift land to Bhramins. So as no bhramins in neighboring Tamil country were willing to go to the newly created land, the locals were initiated into Bhramin hood and taught the Tantram form of worship.
      <<

      Most importantly write separately about Iyengars and the Thenkalai group particularly.

      You have told that Thenkalai sect is R creation and Parkala mutt is too.
      Pls write more about this.
      Also you had stated once that Ranganatha swamy temple in Srirangam follows Kanva Yajur Veda which is poison injected by R.

      I went through this site of the Srivaishnavam.
      It openly bashes Adi Shankara and looks down upon Advaitins.
      www.srivaishnavam.com/faq.html

      It says that only followers of Srivaishnavam sampardaya get moksham.

      Hoping for a long reply and then a longer blog. UNbiased which Advaitinstart in 1800s and British jobs.

      Delete
  88. Dear Sir,

    Big THANKS to you.

    What is Enlightenment ?

    How to attain it ?

    How can we identify (original) enlightened gurus in today's world ?

    Regards,
    Raj

    ReplyDelete
  89. MOTHER TERESA WAS AN EVIL WOMAN . . .

    i have exposed her by only 15%

    http://ajitvadakayil.blogspot.in/2011/02/diabolical-ministering-angel-mother.html

    KERALA NUNS WHO SPENT A LIFETIME WITH HER -- SAY THAT MOTHER TERESA SOMETIMES ACTED AS EVIL AS THE SATAN ITSELF.

    SHE HAD EXORCISTS ATTENDING TO HER . .

    http://news.bbc.co.uk/2/hi/south_asia/1529093.stm

    https://www.theguardian.com/world/2001/sep/07/lukeharding

    HER BEHAVIOR FIT FOR THE SATAN-- REVELING IN PEOPLEs EXTREME PAIN AND SUFFERING WAS KNOWN ONLY TO VERY FEW.

    ReplyDelete
  90. Maxmad
    September 2, 2016 at 6:02 PM

    Captain,before mongols invaded who was the ruler in Tibet ?
    Delete

    ###########################

    Capt. Ajit Vadakayil
    September 2, 2016 at 6:34 PM

    TIBET WAS PART OF INDIA AS LATE AS THE MAHABHARATA WAR IN 4000 BC , WHEN TIBETANS SIDED WITH KAURAVAS.

    INDIA RULED AS FAR NORTH AS URALS IN 7000 BC

    http://ajitvadakayil.blogspot.in/2011/12/stonehenge-of-arkaim-russia-capt-ajit.html

    JEW ROTHSCHILDs HISTORIANS CREATED A FAKE KING BHARAT, USING HIS FAKE AND BACKDATED DASAS.

    IT IS FUCKIN' LIE THAT KING BHARAT WAS SON OF THE FAKE AND BACK DATED SHAKUNTALA

    WE IN INDIA NEVER HEARD OF SHAKUNTALA TILL THE WHITE INVADER CAME TO INDIA.
    KALIDASA LIKE EVERY OTHER DASA NEVER EXISTED .

    http://ajitvadakayil.blogspot.in/2013/06/kalidasa-did-not-exist-jainism-is.html

    THE REAL EMPEROR BHARATA WAS THE SON OF EMPEROR RISHABA -- HE RULED TIBET .

    SVAYAMBHUVA MANU ( 8275 BC ) — PRIYA VARTA ( 8255 BC )- AGNIDHARA – NABHI RAJA -- RISHABHA (8190 BC ) – BHARATA ( 8165 BC ) .

    Emperor Rishabha ( Adinath ) , the father of Chakravatri Bharata is the founder of Jainism in 8190 BC, and is the first Thirthankara.

    IF CHINA ACTS TOO FUNNY , WE WILL SNATCH BACK TIBET .

    capt ajit vadakayil
    ..

    ReplyDelete
  91. he Benami media have got instructions from their foreign masters to praise Mother Teresa , as she will be made a saint tomorrow . .

    Even PM Modi will jump into the bandwagon .. .

    Karo bhaiyya , make this evil woman a god , who cares ? ..

    http://ajitvadakayil.blogspot.in/2011/02/diabolical-ministering-angel-mother.html

    CHRISTIANITY IS ROOTED IN FOUL LIES . . .

    http://ajitvadakayil.blogspot.in/2015/10/true-founder-of-christianity-jesus.html

    This religion has destroyed mankind and killed maximum people . .

    http://ajitvadakayil.blogspot.in/2016/03/st-patrick-genocide-of-druids-pope-leo.html

    KARO BHAIYYA !

    Know the truth how Christianity was spread on this planet . .

    http://ajitvadakayil.blogspot.in/2012/07/fransisco-pizarro-hernan-cortez.html

    http://ajitvadakayil.blogspot.in/2013/01/christopher-columbus-father-of-american.html

    capt ajit vadakayil
    ..

    ReplyDelete
  92. FRANCIS XAVIER WHO SETTLED DOWN IN GOA WAS IMMUNE TO SMALL POX . .

    AS SOON AS THE JESUIT FRANCIS XAVIER CAME TO GOA , HE KILLED MORE THAN 30,000 HINDUS ( MOSTLY ) CHILDREN BY SMALL POX VIRUS -- ADMINISTERED IN TEMPLES .

    HE THEN TOOK A SHIP AND WENT AWAY TO SRI LANKA AND THE FAR EAST.

    THIS CAUSED MOST HINDUS TO RUN AWAY TO MANGALORE AND KERALA IN 1546 AD

    http://ajitvadakayil.blogspot.in/2010/12/portuguese-inquisition-in-goa-and.html

    IT WAS NOT THE BRAVE WHITE MAN -- BULL OF HUNDREDS KILLED MILLIONS OF NATIVES

    http://ajitvadakayil.blogspot.in/2012/07/fransisco-pizarro-hernan-cortez.html

    IT WAS SMALL POX VIRUS . .

    http://ajitvadakayil.blogspot.in/2013/01/christopher-columbus-father-of-american.html

    THE JESUITS NEVER DID THIS FOUL SMALL POX GENOCIDE ON THE WHITE SKINNED MAN-ONLY BLACK HEATHEN NATIVES NEEDED TO BE EXTERMINATED IF THEY DO NOT AGREE TO BE CONVERTED SLAVES.

    capt ajit vadakayil
    ..

    ReplyDelete

  93. Capt. Ajit VadakayilSeptember 5, 2016 at 11:06 PM
    nobeatingroundthebush
    September 5, 2016 at 10:13 PM

    Keith Vaz British MP and friends of some very famous anal sex promoting Indians caught with his pants down with male prostitutes.....LOL......

    ReplyDelete
    Replies
    ############################

    Capt. Ajit Vadakayil
    September 5, 2016 at 11:03 PM

    IN THE VIDEO KEITH VAZ ASKED THE MALE PROSTITUTES FOR POPPERS

    WANNA KNOW WHAT THIS IS ?

    AIDS CAME TO THIS PLANET DUE TO POPPERS USED BY GAYS FOR ANAL SEX . .

    Almost all male homosexuals in the West use nitrite inhalants (amyl nitrites, called "poppers"). On chemical tankers we have it , for use when we load isocyanates like TDI , MDI , PAPI etc.

    It comes in small glass ampoules that were crushed to release their vapors, and received the name "poppers" as a result of the popping sound made by crushing the ampoule.

    When there is a problem we crush Amyl Nitrite capsules 5 times at 15 second intervals and hold under nose of victim.

    http://ajitvadakayil.blogspot.in/2010/06/mdi-diphenylmethane-diisocyanate-bhopal.html

    Amyl nitrite is a vasodilator with the formula C5H11ONO.

    The homosexuals use it as an inhalant, to expands blood vessels, increase heart rate for the euphoric state , relax the involuntary muscles -basically the anal sphincter.


    The effects set in within a few seconds. There is NO time for foreplay in dirty toilets or dark corners in parks. They are more orgasmic oriented, as opposed to pleasuring someone.

    Before Amyl Nitrate came on the scene( to prevent painful anal fissures and ulcers ) in the gay community there was no AIDS.

    In the 1991 film The Doors, Jim Morrison, played by Val Kilmer, sniffs Amyl Nitrite from a glass ampule in an elevator immediately before gay sex. Morrison died at age 27.

    Inhaled nitrites interact freely with endogenous trivalent nitrogen compounds to produce carcinogenic nitrosamines. Virtually all the early homosexual patients later diagnosed with AIDS had used poppers. Nitrites act on blood vessels, the site of KS, AIDS-related KS [Kaposi’s Sarcoma] and are known to be mutagenic. Poppers are immunosuppressive.

    AIDS-related KS [Kaposi’s Sarcoma] lesions occur most often on the chest and face, especially the nose; those are the body areas most heavily exposed to nitrite vapors. Persistent anal-rectal sexual activity can lead to various pre-cancerous lesions such as Bowen’s disease and Kaposi’s sarcoma.

    Whenever tissues are traumatized, cracked, or abraded, they are vulnerable to bacterial infection, especially when shit is just around the corner.

    FOR MORE INFO ASK A CRYPTO JEW BOLLYWOOD DIRECTOR WHO RELEASES HIS MOVIES IN ISRAEL TOO.

    HE SHOWED HIS FAVOURITE SEXUAL POSITION ( NAMAAZ TYPE POSITION ) IN A CROWDED HALL WITH HIS MOM SITTING IN THE FIRST ROW . .

    http://ajitvadakayil.blogspot.in/2013/06/hiv-does-not-cause-aids-many-aids.html

    capt ajit vadakayil
    ..

    ReplyDelete
  94. SOMEONE ASKED ME

    WHY DO YOU KICK YOUR MOST ARDENT FOLLOWERS ON THEIR COLLECTIVE BALLS AND TWATS ONCE IN A WHILE

    LISTEN-

    I AM NOT A GURU

    I DO NOT NEED FOLLOWERS

    THIS BLOGSITE HAS A MISSION

    IT IS NOT FOR FAME AND FORTUNE

    THE PURPOSE TO TO PUT BALM ON A WOUNDED NATION WHICH WAS ENSLAVED FOR 800 YEARS

    THE PURPOSE IS TO ASK BRAINWASHED PEOPLE TO INTROSPECT --SO THAT THEY CAN BE GOOD WORLD CITIZENS ..

    ASK EVEN MY MOST ARDENT CRITICS AT SEA-- THEY WILL SAY CAPTAIN RAN GOOD SHIPS WITH THE MOST LOYAL CREW

    I RAN MY SHIPS LIKE A COMMANDO UNIT WITH 100% LOYALTY

    ONE DAY AN INCIDENT HAPPENED WHEN I HAD 4 UNCONSCIOUS OFFICERS IN A NITROGEN PURGED TANK

    AFTER THE EVENT BLEW OVER I DID SOME INTROSPECTION

    RESULT ?

    I SAID TO MYSELF -I DONT NEED THIS TYPE OF EXTREME LOYALTY . .

    THIS HAPPENED WHEN I WAS A YOUNG CAPTAIN

    PEOPLE AT SEA KNOW ONLY A WATERED DOWN VERSION OF THE REAL CAPT AJIT VADAKAYIL

    THIS BLOGSITE ONLY LEADS YOU TO INTROSPECTION-- I GIVE YOU FREE CHOICE BASED ON FREE WILL--

    FUCK ROTHSCHILDs TERM , "THE SHOW MUST GO ON"

    I ASK YOU TO ---LEARN TO FACE YOUR OWN SHADOWS LEST YOU SEE THEM IN OTHERS -- THE WORLD OUTSIDE IS ONLY A REFLECTION OF THE WORLD INSIDE YOU.

    I CONVERT MY READERS TO PHILOSOPHERS -- YOU CANT BE ONE UNLESS YOU INTROSPECT LIKE OUR MAHARISHIS --

    I AM A MASTER OF CHANGE , THIS PLANETs BEST -- PROBABLY BECAUSE I HAVE TRAVELLED--

    I KNOW WHAT I AM DOING --

    THIS METHOD IS THE FOUNTAIN HEAD TO WISDOM ( YOU CANT GET WISDOM IN ASHTAVAKRA GITA CREATED BY THE WHITE INVADER )

    DONT VIEW THE WORLD LIKE A BIRD ALWAYS SITTING ON THE SAME BRANCH--

    TRYING FLYING AROUND -- TRY SITTING ON ANOTHER BRANCH ON THE OPPOSITE SIDE FOR ANOTHER LATERAL VIEW AND PERSPECTIVE . .

    DONT BE TOO MUCH PREOCCUPIED WITH WHAT IS HAPPENED AROUND YOU--

    TRY PAYING ATTENTION TO WHAT IS GOING ON INSIDE YOU--

    TRY INTROSPECTION-- WITNESS YOURSELF LIKE THE MAHARISHIS OF YORE . .

    YOU DONT GET DOGMA IN THIS BLOGSITE --SOMETIMES I DO A BACKSWING . .IT SERVES A PURPOSE

    THE PURPOSE OF LIFE IS TO BE HAPPY - - AT THE SAME TIME , BE CREATIVE--

    THE PURPOSE OF LIFE IS TO PASS ON A LEGACY , TO LEAVE A WEE FOOTPRINT BEHIND , THAT YOU EXISTED AT ALL ON THIS PLANET - IF YOU CANT MAKE A DENT IN THE UNIVERSE LIKE TESLA ..

    DONT BE A LIKE THAT ROGUE WOMAN WHO JUST BECAME A SAINT AT VATICAN . .

    YOUR CHARACTER IS WHAT YOU ARE -- YOUR REPUTATION IS CREATED BY VESTED FORCES ..

    EGGS WHEN BROKEN FROM WITHIN CAUSES LIFE TO BEGIN--WHEN BROKEN FROM OUTSIDE DESTRUCTS LIFE

    WHEN I WANT TO PSYCHE MY BOSSES I SEND THEM AN EMAIL--
    #######

    VADAKAYIL KHUD QUESTION PAPER DAALTHA HAI

    VADAKAYIL KHUD IMTIHAN LIKTHA HAI

    VADAKAYAL KHUD NUMBER DETA HAI

    ##########

    THIS IS THE MEANING OF LIBERATION

    capt ajit vadakayil
    ..

    ReplyDelete
    Replies
    1. SOMEONE WANTED TO KNOW HOW MAHARISHIS DID INTROSPECTION . .

      WELL --

      THE ANCIENT METHOD OF TEACHING IN A GURUKUL WAS BY NIDIDHYASANA .

      IT WAS ABOUT INTROSPECTION . .

      IT IS ABOUT CHEWING THE CUD . .

      ATMA VICHARA . .

      IT IS ABOUT YOUR BODY CELL MEMORY, RECHARGING WITH WISDOM . . . .

      http://ajitvadakayil.blogspot.in/2014/10/shravana-manana-nididhyasana-way-of.html

      THE ANCIENT GURUKUL NEVER GAVE ANSWERS TO A YOUNG STUDENT KING - - HE HAD TO FIND HIS OWN ANSWERS ..

      THE GURU CATAYSES THE PRINCEs THOUGHTS , AND CORRECTS HIM ONLY IF HE GOT IT COMPLETELY WRONG . .

      http://ajitvadakayil.blogspot.in/2011/02/super-panchatantra-capt-ajit-vadakayil.html

      BODY CELL MEMORY ?

      I ONCE SAVED MY OWN LIFE AND MY CREW BY ALLOWING PANCATANTA WISDOM RULE MY DECISIONS IN EXTREME CRISIS .

      IT WAS ABOUT A FIGHT BETWEEN THE WIND AND THE MOUNTAIN . .

      I OFFERED MY SHIP ONLY TO THE WIND WHICH IS COMPRESSIBLE, NEVER TO THE SEA –

      http://ajitvadakayil.blogspot.in/2010/12/super-typhoon-bart-perfect-storm-capt.html

      capt ajit vadakayil
      ..

      Delete
  95. http://zeenews.india.com/cricket/woah-yuvraj-singh-takes-down-shobhaa-de-and-her-ilk-with-these-scathing-remarks_1926420.html

    I NEVER LIKED YUVRAJ SINGH

    BUT NOW I LIKE HIM . .

    HOW MANY SCHOOLS IN INDIA HAVE A PLAYGROUND ? FORGET ABOUT SWIMMING POOL . .

    THE BLOGSITE IS GRATEFUL TO DIPA KARMAKAR FOR SHOWING INDIA , THAT WE CAN DO IT

    I HAVE DONE IN MY OWN WAY , BY A BLOGSITE TO SHOW INDIANS , THAT WE MUST BE PROUD OF OURSELVES --THAT WE CAN DO IT

    DIPA KARMAKAR HAS FIRED THE IMAGINATION OF INDIANS-- LIKE NO ATHLETE EVER BEFORE

    SHOBHAA DE CALLS HERSELF THE NO 1 WRITER IN INDIA USING HER WESTERN CONTACTS.

    SHE HAS A PROPAGANDA MACHINE THAT HER PUERILE SEXUAL SLIME LOADED BOOKS ARE COURSE MATERIAL IN LONDON UNIVERSITY.

    https://twitter.com/DeShobhaa/status/772050093398757376

    OH YEAH ?

    THIS FRENCH WINE ( ON KNEES ) LOVING WOMAN HAS A PROFILE VIEW OF 1.3 LAKHS , THOUGH I STARTED BLOGGING 3 YEARS AFTER HER

    https://www.blogger.com/profile/05610708004901279105

    HERE IS MINE -- 50.1 LAKHS

    https://www.blogger.com/profile/14410812789424637654

    PROOF OF THE PUDDING LIES IN THE EATING -- NOT PROPAGANDA SHIT

    THIS KALANK TO INDIAN WOMANHOOD SHOBHAA DE IS ONE OF THE MOST HATED WOMEN IN INDIA . .

    ReplyDelete
  96. http://insideepaclimate.com/daily-news/white-house-adds-methane-nitrous-oxides-social-cost-carbon-tool

    THIS BLOGSITE IS THE ONLY SITE WHICH PUSHED FOR THIS

    AND HENCE WILL TAKE CREDIT 100%

    HULLO PMO--

    IS THIS FICTION ?

    OR IS IT SOME DREAM LIKE " MUNGERILAL KE RANGEEN SAPNE " ?

    WHEN I WROTE THIS POST BELOW PMO CALLED IT FICTION .

    http://ajitvadakayil.blogspot.in/2016/04/most-potent-greenhouse-gases-nitrous.html

    NOW THAT GORA GAAANDS HAS TOLD IT-- PMO WILL AGREE

    ANGREZ KA SLAVES , STILL RUNNING PMO !

    capt ajit vadakayil
    ..

    ReplyDelete
  97. I HAD WARNED THIS PLANET ABOUT NANO PARTICLES INVADING THE BLOOD BRAIN BARRIER

    http://ajitvadakayil.blogspot.in/2015/10/interstitial-lung-disease-nano-carbon.html

    http://ajitvadakayil.blogspot.in/2015/12/asd-atrial-septal-defect-hole-in-heart.html

    AM I STUPID TO WRITE THE POSTS ABOVE?

    IF I DONT WRITE IT, NOBODY WILL OR CAN.

    SOMEONE IS PAYING ATTENTION

    NANO PARTICLE PEACE TIME WARFARE IS GOING ON DEGRADE HUMAN BRAINS AND HEALTH.

    https://www.theguardian.com/environment/2016/sep/05/toxic-air-pollution-particles-found-in-human-brains-links-alzheimers

    WHY DID I WRITE A POST ON GOMUTRA OF HUMPED VEDIC COW ?

    IN ADDITION TO ENZYMES OF HUMPED COW URINE BUSTING THE PROTECTIVE ARMOUR OF BACTERIA/ VIRUS/ FUNGI--

    THERE ARE GOLD NANO COLLOIDS WHICH INVADE THE HUMAN BLOOD BRAIN BARRIER AND SELECTIVELY ATTACK ENEMIES ALONE- NOT FRIENDS

    http://ajitvadakayil.blogspot.in/2013/02/gomutra-drinking-cows-urine-as-elexir.html

    YOU MUST KNOW THAT YOUR HUMAN GUT CONTAINS GOOD AND BAD BACTERIA

    IF YOU KILL THE GOOD BACTERIA WITH EXCESSIVE USE OF ANTIBIOTICS YOU WILL DIE

    I HAVE MADE MORE THAN 10,000 REVELATIONS IN MY BLOGS

    ALL WILL BEAR FRUIT AND PROVE TO BE TRUE

    WITNESS ME !

    http://ajitvadakayil.blogspot.in/2016/01/candida-albicans-darling-of-evil-pharma.html

    capt ajit vadakayil
    ..

    ReplyDelete
  98. timesofindia.indiatimes.com/city/thiruvananthapuram/RSS-organ-paints-a-different-pic-of-Onam/articleshow/54260672.cms

    RSS DOES NOTHING FOR HINDUS . . .

    RSS SUPPORTS HOMOSEXUALITY . . .

    KERALA DOES NOT CELEBRATE DIWALI AND RAKKSHA BANDHAN LIKE THE REST OF INDIA . . . .. WE ARE KNOWN BY OUR FESTIVALS . .. . .

    ONAM IS NOT CELEBRATED BECAUSE BELOVED ASURA KING MAHABALI CONDUCTED ASHWAMEDHA YAGNA AND BECAME EMPEROR , MAKING DEVAS JEALOUS .. .

    ajitvadakayil.blogspot.in/2011/09/why-kerala-does-not-celebrate-diwali-or.html

    AFTER DRIVING KING MAHABALI TO PATALA VISHNU DEVELOPED PANGS OF GUILT AND STAYED WITH MAHABALI IN PATALA ( PERU )

    WIFE LAXMI TIED A RAKHI ON THE HAND OF MAHABALI , WHO FORCED VISHNU TO GO BACK TO VAIKUNTA. . .

    ajitvadakayil.blogspot.in/2012/07/maya-inca-aztec-civilizations-decoded.html . . . .

    RSS IS NOW ENGAGED ONLY IN MILKING VOTES .. . RSS IS CONTROLLED BY FOREIGN KOSHER FORCES .. . . THEY WORK AGAINST HINDU INTERESTS . . . . . .

    ajitvadakayil.blogspot.in/2013/03/kodungallur-bharani-festival-capt-ajit.html

    capt ajit vadakayil
    ..

    ReplyDelete

  99. தென்னவன்

    September 10, 2016 at 4:47 PM

    RSS is now calling Onam as VAAMANA JAYANTHI


    ############################
    Capt. Ajit Vadakayil
    September 10, 2016 at 6:08 PM

    hi t,

    IF IT IS VAMANA JAYANTI, THE REST OF INDIA ( EXCEPT KERALA ) SHOULD CELEBRATE IT . . .

    VISHU AS VAMANA BANISHED MAHABALI ONLY BECAUSE HE DID ASHWAMEDHA YAGNA SUCCESSFULLY UNDER INSTIGATION BY SHUKRACHARYAs. . . .

    THIS IS SHUKRACHARYAs ( MENTOR OF ASURAS ) VICTORY --

    BITTER RIVAL BRIHASPATIs SON KACHA HAD DONE FOUL AND IMMORAL LOVE JIHAS ON SHUKRACHARYs DAUGHTER DEVYANI . . THERE WAS ENDLESS ENMITY . .

    THE WHOLE WORLD AT A TIME MILLENNIUMS AGO WERE DIVIDED BETWEEN SHUKRACHARYA WORSHIPERS AND WORSHIPERS BITTER RIVAL BRIHASPATI ( MENTOR OF DEVAS )

    SHUKRACHARYA WORSHIPERS HAD FRIDAY AS HOLIDAY AND BRIHASPATI WORSHIPPERS HAD THURSDAY AS HOLIDAY . . .

    SHUKRACHARYA WAS REJECTED AS MENTOR OF DEVAS THOUGH HE WAS BETTER THAN GURUKUL CLASSMATE BRIHASPATI IN EVERY RESPECT --

    BRIHASPATIs FATHER MAHARISHI ANGIRASA WAS A GREAT GURU AND HENCE DEVAS CHOSE BRIHASPATI AS THEIR MENTOR OVER SHUKRACHARYA, THOUGH SHUKRACHARYA WAS MILES AHEAD OF BRIHASPATI , EVERY WHICH WAY . .

    WE IN KERALA DO NOT CELEBRATE DIWALI AS THIS IS MEANT TO CELEBRATE THE VICTORY OF DEVAS OVER ASURAS.

    INSTEAD WE CELEBRATE ONAM IN GRATITUDE TO A GREAT A BELOVED ASURA RULER KING MAHABALI .. ONAM IS CELEBRATED BY KERALA MUSLIMS AND CHRISTIANS TOO ..

    THERE IS NO RELIGIOUS DIVIDE IN KERALA OVER ONAM , IT IS AMAZING ..

    ATHEIST COMMIES LIKE PINARAYI VIJAYAN ( CM OF KERALA ) IS TRYING TO SUPRESS ONAM . . ONAM DISRUPTS THEIR COMMIE ANTI-WATAN AGENDA . . .

    http://ajitvadakayil.blogspot.in/2011/09/why-kerala-does-not-celebrate-diwali-or.html

    PARSIS CALL THEIR GODS ASURAS ( AHURA ) AND VICE VERSA.

    PARSIS CANT PRONOUNCE S --THEY INSERT H.

    LIKE HOW CHINESE AND JAPANESE SUBSTITUTE L FOR R AND VICE VERSA . . .

    http://ajitvadakayil.blogspot.in/2012/05/thor-zeus-marduk-brihaspati-and-jupiter.html

    WESTERN PEOPLE STILL WORSHIP BRIHASPATI AS ZEUS , THOR etc . .

    http://ajitvadakayil.blogspot.in/2012/05/thor-zeus-marduk-brihaspati-and-jupiter.html

    FESTIVALS CELEBRATED FROM YORE , NEVER LIE ..

    capt ajit vadakayil
    ..

    ReplyDelete
  100. Karvjyot
    September 12, 2016 at 10:42 PM

    Who was Adi Buddha ?

    ReplyDelete
    Replies
    ###################

    Capt. Ajit Vadakayil
    September 12, 2016 at 11:05 PM

    hi k,

    The Gautama Buddha propagated by Jew Rothschild’s historians is a NOT the real Buddha.

    The first Buddha was Adi Buddha who lived in 1900 BC of Ikshvaku lineage whose preceptor was a Maharishis Vashista. Buddha can never be the ninth Vishnu avatar .

    He was born a century AFTER Adi Shankaracharya died.

    He was a contemporary of Mahavira the 24th Tirthankara.

    The first Thirthankara was Emperor Rishabha 8190 BC ( Adinath ) , the father of Chakravatri Bharata . India is named after BHARATA .

    BHARATA the son of the FAKE AND BACKDATED creation of Jew Rothschild , son of Shakuntala is FAKE.

    Dr. S. Radhakrishnan, ex-president has written, "Jain tradition ascribes the origin of the system to Rishabhadeva, the first Tirthankara. The Yajurveda and Bhagawata Purana mentions the name of Rishabha "

    Emperor Asokha never existed. He was a FAKE and backdated creation of Jew Rothschild.

    Capt ajit vadakayil
    ..

    ReplyDelete
    Replies

    1. Ishan Sharma
      September 12, 2016 at 11:57 PM

      Respected Captain
      http://ajitvadakayil.blogspot.in/2013/06/kalidasa-did-not-exist-jainism-is.html
      But in this blog you have written that Mahavira, the 24th Tirthankara, was born in 4500 BC. Then how is it possible that he was a contemporary of Adi Buddha? Is it a typo or is it some new revelation?
      Regards

      Delete
      ##################
      Capt. Ajit Vadakayil
      September 13, 2016 at 1:01 AM

      KORREKSHUN

      BUDDHA 1900 BC

      MAHAVIRA 4500 BC

      http://ajitvadakayil.blogspot.in/2013/07/difference-between-buddha-and-mahavira.html

      Delete
  101. http://ajitvadakayil.blogspot.in/2015/11/pol-pot-of-khmer-rouge-great-cambodian.html

    I WAS WATCHING RAMBO 2 MOVIE A FEW DAYS AGO

    THE MOVIE TOLD THE TRUTH

    USA WAS SUPPOSED TO GIVE VIETNAM WAR REPARATIONS IN CASH

    THE US PRESIDENT PROMISED TO WOW THE WORLS --IN REALITY USA NEVER PAID UP

    THE US POWs WERE DETAINED TO FORCE USA TO PAY UP WHAT THEY PROMISED.

    IT WAS NOT ABOUT EVIL VIETNAMESE HOLDING INNOCENT BABES IN THE WOODS HOSTAGE --THEY HELD BACK ONLY THE WORST CRIMINALS

    BUT HEY, USA PAID UP FOR JOHN MC CAIN . .HIS FATHER WAS POWERFUL

    http://ajitvadakayil.blogspot.in/2011/09/deadly-fire-on-aircraft-carrier-uss.html

    capt ajit vadakayil
    ..

    ReplyDelete
  102. Gama Pada
    September 16, 2016 at 3:48 PM

    Hi Ajit

    Well well interesting Noam's article here --> https://chomsky.info/201401__/

    ReplyDelete
    Replies
    #############
    Capt. Ajit Vadakayil
    September 16, 2016 at 7:15 PM

    hi gp,


    French THIEF Rene Descartes is known as the father of western philosophy, and Analytical Geometry

    WHATEVER SENSIBLE STUFF HE PEDDLED WAS ALL LIEFTED FROM INDIA AS DUCTH EAST INDIA COMPANY SHIPS WERE TRADING WITH CALICUT KING.. .

    The shipping company was called Verenigde Oost-Indische Compagnie or VOC..

    Before Jew Rothschild JEWESS Gracia Mendes Nasi was trading in spices with the Calicut King.

    Today the Israeli mint has produced a commemorative medal in Gracia baby’s name.

    VATICAN BANNED RENE BABYs BOOKS .

    THIEF Isaac Newton and THEIF Gottfried Leibniz, had access to Calculus THIEF Descartes stole from the Kerala School of Math.

    His work Descartes on REFLECTION and REFRACTION was stolen from India.

    http://ajitvadakayil.blogspot.in/2011/01/isaac-newton-calculus-thief-capt-ajit.html

    http://ajitvadakayil.blogspot.in/2011/10/total-internal-reflection-capt-ajit.html

    YEH NASI KAUN SA KHET KA BEETROT HAI BEH ?

    The Jews always had a secret NASI ( nazi ) leader –till Israel was carved out.

    Bar Kokhba was a NASI

    Rabbi Yehudah Ha NASI was the editor of the Mishnah in its final form.

    Rabban Gamaliel II was a NASI --the first person to lead the Sanhedrin as Nasi after the fall of the second temple, which occurred in 70 AD. Onkelos performed the mourning ritual for Rabban Gamaliel II as though he were a king

    David Ben Zemah was a NASI
    Malkhi ben Sar Shalom was a NASI
    Daniel b. Azariah was a NASI
    Daniel and Jedidiah b. Zakkai were NASI
    Shem Tov was a NASI
    Gracia Mendes NASI was one.
    Dom Joseph NASI was one ( nephew of Dona Gracia Mendes NASI) A Court Jew, he was appointed the Lord of Tiberias
    Roth- the house of NASI we all know.
    Hilter was a NAZI ( nasi ).

    ALL NAZIS ARE NOW OUT OF THE CLOSET—

    http://ajitvadakayil.blogspot.in/2015/10/if-zionist-jews-created-isis-who.html

    HITLER WAS A NAZI ( NASI )
    http://ajitvadakayil.blogspot.in/2014/12/exhumed-truths-of-spanish-armada-and.html

    In 1512, the House of Mendes, had TOTAL monopoly of the pepper trade exported by the Calicut king ( my hometown ) recently encountered India, enabled it to open a branch office in Antwerp.

    In 1498 Vasco Da Gama had landed in my hometown Calicut " discovering " India.

    Crypto Jewess widow Dona Gracia Mendes, ( Senyora Beatrice de La Luna Nassi),was a great heroine for the crypto Jews Marranos,

    MAJJA HAI
    KISSI KOH KICH NAAHI PATHA !

    Capt ajit vadakayil
    ..

    ReplyDelete
  103. THE INDIAN GOVT AND ARMED FORCES MUST DO BRAINSTORMING .

    ATTACK ONLY WEAK POINTS OF PAKISTAN . .

    THIS IS CHANAKYA NEETI . .

    one of the reasons why capt ajit vadakayil is a living legend at sea, is because i offered myself as a SACRIFICIAL GOAT just to get my kicks and play games with my detractors

    i would offer to change cargo grades which had never been tried before at sea.

    for example-- i would offer to change grade from viscous lub oils to potable ethanol or methanol fibre grade in brazil/ argentina and that too without going out to sea for open tankcleaning after unloading luboil .

    yank charteres wanted to send yank , danish and norwegian obeservers ( super cargoes ) and i would say NO PERMISSION --

    TARZAN SWINGS ALONE ON THE VINES -- AND HE WONT ALLOW IDIOTS TO WATCH FROM BELOW AND ABOVE TO MICROMANAGE HIM. .

    i make too many enemies ho are miffed with my cockiness-- if i fail i am disgraced forever and will be sacked. even the company may shut down due to losses . .

    my detractors would wait with bated breath for me to fall PHUTTTTT on mE face.

    but i would always win . .

    THUMB RULE : KNOW THE WEAK POINTS AND STRONG POINTS OF THE PREVIOUS CARGO. ATTACK WEAK POINTS . IT REQUIRED IN DEPTH TECHNICAL KNOWLEDGE FROM IONS TO ATOMS TO MOLECULES TO BOILING POINTS TO MELTING POINTS TO WHATEVER.

    THERE WAS A CASE --MY LAST VOYAGE BEFORE I RETIRED --MY TANKS ALL FAILED AT OMAN --

    ALL MY DETRACTORS CELEBRATED AND GOT DRUNK

    I CAME OUT THE WINNER AGAIN--SO WHAT ELSE IS NEW ?

    I CHALLENGED THE COMPETENCE OF THE GORA INSPECTION LAB ..

    I DID TESTS ON MY OWN SHIP --IN THE PRESENCE OF LAWYERS FROM LONDON-- HAD THE TESTS VIDEO TAPED .

    THE VERDICT?

    THE SHORE LAB , MUST RE-TRAIN THEIR TECHNICIANS -- THEIR PROCEDURES WERE NOT SCIENTIFIC -- THE TOP BOSSES GOT SACKED.

    THIS IS THE REAL MEANING OF " GAAND MEIN TATTI " OR BALLS WHICH CLANG AND EMIT SPARKS .

    TODAY EVEN MY DETRACTORS WHO GOT DRUNK-CRY-- THIS WILL NEVER EVER HAPPEN ON THIS PLANET . .

    http://ajitvadakayil.blogspot.in/2012/07/my-experience-at-mundra-port-adani-sez.html

    http://ajitvadakayil.blogspot.in/2012/05/wall-wash-ptt-without-tears-chemical.html

    i want all my readers to read above TWO posts--

    LIFE LESSON IS INHERENT !

    ONLY YOU CAN FAIL YOURSELF --NOT ANY OTHER MORTAL ON THE PLANET- THE DAY YOU CAN DO THAT, YOU ARE LIBERATED.

    VADAKAYIL KHUD EXAM PAPER DAALTHA HAI

    VADAKAYIL KHUD IMTIHANN LIKTHA HAI

    VADAKAYIL KHUD NUMBER DETHA HAI . . .

    WHATEVER YOU DO IN LIFE--UNDERSTAND WHAT YOU DO-- 100% FROM MACRO TO MICRO LEVEL-- GO FROM TELESCOPE TO MICROSCOPE MODE AGAIN AND AGAIN

    capt ajit vadakayil
    ..

    ReplyDelete
  104. http://indianexpress.com/article/india/india-news-india/fascism-debate-reaches-cpm-top-body-sitaram-yechury-sticks-to-stand-3039686/

    COMMUNIST PARTY SUPPORTED CHINA DURING 1962 INDIA CHINA WAR

    COMMUNIST PARTY SUPPORTED ROTHSCHILD IN 1942 QUIT INDIA MOVEMENT

    DO NARCO TEST ON TOP NAXAL/ MAOIST LEADERS AND YOU WILL KNOW WHO PROVIDES THINKING

    WE DO NOT WANT ELECTED EXECUTIVE TO TAKE PERMISSION FROM COLLEGIUM JUDGES BEFORE DOING NARCO TEST

    NARCO TEST ON NAXALS AND SEPARATISTS ARE RESISTED BY FOREIGN DESH DROHI FORCES

    http://www.thehindu.com/news/national/use-of-narco-analysis-brainmapping-unconstitutional-court/article422149.ece

    THE REASON IS TOP JUDGES, RAJYA SABHA MEMBERS, MEMBERS OF NHRC ARE INVOLVED IN BLEEDING BHARATMATA

    GN SAIBABA IS A BLACK MAMBA

    http://www.thehindu.com/news/national/gn-saibaba-says-government-wanted-to-kill-him/article8448435.ece

    HAS ASARAM BAPU AND SADHVI PRAGYA TRIED TO KILL BHARATMATA --OR SAVE HER ?

    EVERY TIME OUR UNIFORMED MEN RISK THEIR LIVES AND NAB NAXALS THE SUPREME COURT COLLEGIUM JUDGES SAVE THEM --JUST A PIL IS ENOUGH--AND THEY MADE AND BREAK RULES

    http://www.dnaindia.com/mumbai/report-sc-relief-for-binayak-sen-gives-hope-to-jailed-activists-1258994

    READ ALL 8 PARTS OF THIS POST BELOW--

    http://ajitvadakayil.blogspot.in/2016/03/foreign-funded-trojan-horse-ngos-pil.html

    capt ajit vadakayil
    ..

    ReplyDelete
  105. Somebody asked me about burial of Jivan Mukhts being BURIED .

    SORRY—

    WE NEVER BURIED OUR JIVAN MUKHTS UNDER THE GROUND .

    WE INTERNED THEM ABOVE THE GROUND IN A MUNIYARA ( WE CALL DOLMENS MUNIYARAS ).

    THEY WERE INTERNED IN YOGA NIDRA POSITON .

    Muniyaras are dolmens ( burial chambers ) made of four stones placed on edge and covered by a fifth stone called the cap stone

    When the white invader came to India we had more than 5000 muniyaras in Kerala alone – all of them on mountain tops of Western Ghats. Today there are just 400 muniyaras in Kerala—ones which were NOT noticed by the white invader.

    https://www.tripadvisor.in/Attraction_Review-g303881-d1371324-Reviews-Muniyara_Dolmens-Munnar_Idukki_District_Kerala.html#photos;geo=303881&detail=1371324

    The white BASTARDS took away these huge slabs of granite by breaking them into pieces. This was an EXTREME form of cultural terrorism, because Europe , Russia , Korea, and the world over were full of Dolmens—of Druids ( ancient Hindu sages )

    http://ancients-bg.com/dolmens-menhirs-cromlechs-the-magical-stones/

    Before 7000 BC, india ruled the whole world ,and there was only ONE religion

    HINDUS NEVER EVER BURIED ANYBODY INDER THE GROUND—VEERASHAIVA LINGAYATHS ( CREATED BY JEW ROTHSCHILD ) PLEASE NOTE

    http://ajitvadakayil.blogspot.in/2016/03/st-patrick-genocide-of-druids-pope-leo.html

    capt ajit vadakayil
    ..

    ReplyDelete
  106. https://twitter.com/mkatju/status/778460947744641024

    IDIOT KATJU DOES NOT KNOW THAT THE WRONG THUMB WAS ASKED FOR AND GIVEN.


    Dronacharya taking away Ekalavya’s thumb to make Arjuna the best archer , and because he is low caste is POISON INJECTED by the white christian invader to alienate dalits for divide and rule.

    Dronacharya asked for his right thumb as Gurudakshina.

    Much later in life the Pandavas with Drona had a second meeting with Ekalavya.

    This was after Yudhishtar did the Rajasuyayoga, five Pandavaas visited Hastinapur and Dronacharya suggested that they go for hunting to same forest.

    Same situation, same dog, and Ekalavya pasted the dog before Arjuna could react -- once more.

    At that time Drona explained about the thumb.

    By asking for guru dakshina I accepted Ekalavya, as my student.

    By chopping off his thumb and offering it as guru dakshina, Ekalavya showed he was noble despite his low caste.

    Drona explained that knew he was a left hander.

    He held the bow with his right hand. His arrow-bush was attached to his left shoulder. His short sword with its holder was hanging on his right side.

    Arjuna apologized to Ekalavya for his jealousy- and they hugged ..

    REALLY IT IS NOT WORTH REPUDIATING ALL THESE FAKE STORIES PLANTED.

    let hindus continue worshipping a fake radha and let the dalits continue believing that manu wanted to pour molten lead in their ears if they listen to vedas.

    HINDUISM HAS SURVIVED 800 YEARS OF OPPRESSIVE SLAVERY -- AND WILL SURVIVE..

    FOR THIS IS THE ONLY RELIGION WITHOUT A VESTED AGENDA.

    capt ajit vadakayil
    ..

    ReplyDelete

  107. shailesh M
    September 22, 2016 at 4:22 AM

    The main problem of rajiv dixits followers is that they know they are in a war, but they dont really know whom they are supposed to be fighting with, they cannot pinpoint their real enemy. And I am interested to know wether rajiv dixit himself didnt knew about the zionist hand in indian affairs and how they work or did he purpoself kept quiet. If he purposely kept quiet then it tells something about him, and for me it is difficult to imagine that he didnt knew about these people.

    Also why was he murdered? Who did it ? was it by baba ramdev ? r someone else? and why?

    People say that he was murdered because he was awakening the masses..but was he really awakening the people by not uttering the R word? All these are not so explain.

    Delete
    ##############################

    Capt. Ajit Vadakayil
    September 22, 2016 at 10:08 AM

    TILL CAPT AJIT VADAKAYIL CAME ON THE INTERNET SCENE

    DID ANY SON OF A BITCH EVER UTTER OR WRITE THE WORD "ROTHSCHILD"

    SO WHAT ARE ALL OUR HISTORIANS WORTH ?

    EITHER THEY ARE IGNORANT OR THEY ARE AFRAID

    SUBRAMANIAN SWAMY AND RAJIV MALHOTRA HAVE TAKEN IT UPON THEMSELVES TO SAVE INDIA AND HINDUSIM?

    HAVE THEY EVER UTTERED THE R WORD ?

    WHEN I FIRST WROTE ABOUT ROTHSCHILD -- ALL DEMANDED TO KNOW --ROTHSCHILD WHO?

    SOME WENT TO THE EXTENT OF SCREAMING--CAPTAIN HAS A R FIXATION !

    WELL JEW ROTHSCHILD RULED INDIA -- HE WAS THE OWNER OF BRITISH EAST INDIA COMPANY --

    HE COULD MAKE THE BRITISH QUEEN AND THE ENTIRE PARLIAMENT DO MURGA POSITION OF THE TABLE - NAKED . .

    HE COULD STRING THEIR COLLECTIVE BALLS AND TWATS AND TUG TO HIS HEARTS CONTENT ANY TIME -WHILE BEING SARCASTIC AT THEIR EXTREME PAIN .

    ROTHSCHILDs WEALTH IS FROM CALICUT- MY HOMETOWN

    I HAVE A PERSONAL STAKE IN THIS - MY GENOME TELLS ME .

    http://ajitvadakayil.blogspot.in/2011/10/tipu-sultan-unmasked-capt-ajit.html

    EVEN TODAY ROTHSCHILD RULES THE WORLD FROM BEHIND THE SHADOWS .

    today you google ROTHSCHILD why does 21 million posts jump out ?

    when rajiv dixit told the entire ramayana --without mentioning ravan --what is his bullshit PARAYAN worth ?

    does rajiv dixit have a technical brain ? yes , he is a great patriot . .

    why does our BENAMI MEDIA keep away from the word R like it is the plague?

    I DARE ANY MP IN THE INDIAN PARLIAMENT LOK SABHA OR RAJYA SABHA TO UTTER THE WORD R.

    LODA LAG JAYEEGA USKA !


    capt ajit vadakayil
    ..

    ReplyDelete
  108. http://www.huffingtonpost.in/2016/05/27/pinarayi-vijayan-allegedly-once-asked-his-party-members-to-add/

    IN ANY OTHER COUNTRY PINARAYI VIJAYAN WOULD BE THROWN INTO JAIL AND DISQUALIFIED PERMANENTLY FROM ELECTIONS .. TODAY THIS ATHEIST COMMIE IS CM OF KERALA. .

    COMMIE SITARAM YECHURY WANTS TO SHOW THAT COMMIE LEADERS ARE GREAT ADVOCATES OF PEACE WHEN HE WANTS ALL STAKE HOLDERS TO DISCUSS URI TERRORIST ATTACK

    THE TRUTH IS COMMIES ARE THE MOST UNRELIABLE TRAITORS ROOTED IN VIOLENCE WITH NO IDEOLOGY OTHER THAN GRABBING POWER AND LAND USING NAIVE ILLITERATE CADRE--ALWAYS FUNDED FROM ABROAD

    THE FRENCH REVOLUTION WAS THE FIRST COMMIE REVOLUTION-- EVEN BEFORE THE TERM "COMMUNIST" HAD BEEN INVENTED BY JEW ROTHSCHILD ..

    http://ajitvadakayil.blogspot.in/2015/11/the-french-revolution-conceived-and.html

    ALL THAT WAS GOOD OF FRANCE DIED IN THIS REVOLUTION-- AND FRANCE HAS BEEN RULED BY SLIMY JEWS EVER SINCE .

    I KNOW MORE ABOUT BOLSHEVIK REVOLUTION IN RUSSIA ,CONSIDERING I HAD OFFICERS SAILING WITH ME FROM EVERY EAST EUROPEAN COUNTRY.

    http://ajitvadakayil.blogspot.in/2013/07/exhuming-dirty-secrets-of-holodomor.html

    MARX WAS A GERMAN JEW--A BLOOD RELATIVE OF GERMAN JEW ROTHSCHILD. STALIN, LENIN, TROTSKY AND EVERY REVOLUTION LEADER WAS A JEW . .

    MAO WAS A JEW . .

    http://ajitvadakayil.blogspot.in/2013/08/chinese-revolution-biggest-genocide-on.html

    A RUSTIC BIHARI IDIOT WHO WANTS PROMOSSSANN, REVOLUSSANNN, AJJADI , SORE LEAVE , BHYABHASSTA , BHINDOW SEAT etc THINKS HE CAN BE A FUTURE PM OF INDIA . ..

    HE THINKS QUIVERING HIS FOREFINGER WHILE TALKING MINDLESS NONSENSE IS SPEECH . .

    THIS TRAITOR NAMED KANHAIYA KUMAR WANTS RAINBOW COALITION COMMIES / DALITS ..

    MIND YOU COMMIE TELUGU SITARAM YECHURYs WIFE IS EDITOR OF INDIAN EXPRESS. .

    http://indianexpress.com/article/india/india-news-india/kanhaiya-kumar-calls-for-rainbow-coalition-between-ambedkarites-communists-3038318/

    KANHAIYA KUMAR HAS THE SUPPORT OF NOAM CHOMSKY, COLLEGIUM JUDGES, NHRC, NCM , HUMAN RIGHTS GROUPS AND FOREIGN FUNDED TROJAN HORSE NGOs WHO RUN THE RED CORRIDOR . .

    AS SOON AS HE CAME OUT OF JAIL HE SPAKE -- PULLISSS NEH YECHOOOOREEE SAHAAB KOH GAALI DEEEYA .

    TEE HEEEEEE

    LISTEN CAN SITARAM YECHURY WIN AN ELECTION ANYWHERE IN INDIA . . LET HIS INDIAN EXPRESS EDITOR WIFE SEEMA CHISTI DO ALL THE CAMPAIGNING -KARKE DIKHA

    WE KNOW HIS SPONSORS IN RAJYA SABHA.

    WE MUST ABOLISH RAJYA SABHA-- MOST MPs ARE ON FOREIGN PAYROLL . . .

    http://ajitvadakayil.blogspot.in/2013/01/abolish-rajya-sabha-capt-ajit-vadakayil.html

    ROTHSCHILD MADE SURE THAT PRESIDENT CANNOT DISSOLVE THE RAJYA SABHA AND THIS HOUSE OF LORDS ( IN HIS POCKET ) CAN VETO ANY BILL PASSED BY LOK SABHA.

    WHITHER DEMOCRACY ?

    COLLEGIUM SYSTEM IS LIKE JNU -- ATHEIST COMMIES RULE THE ROOST . .. ALL THIS IS CONTROLLED FROM ABROAD. .

    capt ajit vadakayil
    ..

    ReplyDelete
  109. http://indiatoday.intoday.in/story/burhan-wani-muzaffar-sri-sri-ravi-shankar-art-of-living/1/750543.html

    THE WHOLE OF INDIA BELIEVES BURHAN WANIs FATHER

    WHEN WILL THIS ROGUE SRI SRI RAVISHANKAR EVER TELL THE TRUTH ?

    WE HAD ENOUGH OF HIS LIES, HIS FAKE SHAKTI OIL AND ENZYMES . .

    IF HE GOES TO A SOUTH AMERICAN COUNTRY HE WILL BE ARRESTED FOR CAUSING IRREVERSIBLE BRAIN DAMAGE TO PEOPLE BY HIS FAKE HYPERVENTILATION YOGA--SUDARSHAN KRIYA.

    http://ajitvadakayil.blogspot.in/2016/07/sanatana-dharma-hinduism-exhumed-and_31.html

    THIS HOMOSEXUALITY PUSHING ROGUE GURU DOES NOT REPRESENT INDIA OR HINDUISM--

    SRI SRI RAVISHANKAR KNOWS NOTHING ABOUT HINDUISM THOUGH HE CLAIMS TO BE AN EXPERT .

    ReplyDelete
  110. FEW INDIAN TRAITORS WANT TO KEEP PEOPLE TO PEOPLE COMMUNICATIONS LINES OPEN TO PAKISTAN . . THEY SAY.

    ALL THEY DO IS TO GO TO PAKISTAN AND ENJOY 7 STAR FACILITIES, FREE BIRIYANI , KABABS --

    --- AND COME BACK TO INDIA WITH EXPENSIVE PRESENTS AND A US DOLLAR CASH DEPOSIT IN THEIR FOREIGN ACCOUNT .

    BHARATMATA DOES NOT GAIN.

    THESE SELFISH INDIAN DESH DROHI BASTARDS GAIN . .

    ALL FUNDED BY ISI --

    WE KNOW WHO THESE TRAITORS ARE.

    ReplyDelete
  111. I have a confession to make

    One of my readers asked me if I heard Modi’s speech at Calicut, and I said YES.

    The truth is that I listened to Venkaih Naidu’s speech. After 10 minutes of hearing Modi’s speech ,I fell into deep REM sleep with the TV’s heavy SONY speakers booming loud.

    After that I went to the gym with my younger son, had beer and dinner and then listened to Modi’s recorded speech.

    My wife said , I snored during my sleep !

    I ASK MODI/ AJIT DOVAL/ RAJNATH SINGH

    DO YOU HAVE POLITICAL WILL?

    ARE YOU “EFFECTIVE” LEADERS ?

    ANSWER ME –

    AFTER ALL THE HOOO HAAA OF KANHAIYA KUMAR IN JNU, HOW IS THAT COMMIES HAVE SWEPT THE JNU ELECTIONS AGAIN?

    IN JAPAN YOUR EQUIVALENTS WOULD HAVE DONE HARAKKIRI

    DON’T YOU HAVE ANY SHAME?

    THIS WOULD HAVE NEVER EVER HAPPENED TO CAPT AJIT VADAKAYIL --

    I WAS AN EFFECTIVE LEADER FOR 30 YEARS WEARING 4 STRIPES !

    The whole of India is still in a state of shock as to how JNU has emerged stronger as a commie base –with Collegium Judiciary backing these anti-watan , anti-hindu commie students and professors.

    IS THIS THE FUTURE OF INDIA?

    IS THIS A INDICATOR OF FUTURE STATE OF AFFAIRS UNDER YOUR LEADERSHIP?

    ARE YOUR TEAMS COMPROMISED ?

    ARE YOU ALL ROTTEN FROM WITHIN?

    ANSWER ME !

    ARE YOU TRUE LEADERS OR JUST MANAGERS ?

    http://ajitvadakayil.blogspot.in/2010/11/blue-ocean-leadership-capt-ajit.html

    LEADERSHIP IS DEFINED BY RESULTS AND NOT BY ATTRIBUTES.

    PUT THIS COMMENT IN MODIs, AJIT DOVALs, RAJNATH SINGHs AND PARRIKKARs WEBSITES . ASK FOR AN ACKNOWLEDGEMENT. WHEN JNU COMMIE STUDENTS SWEPT THE ELECTIONS ALL OVER AGAIN ,MY WIFE ASKED ME-- WHAT IS THE MEANING OF ALL THIS .

    Capt ajit vadakayil
    ..

    ReplyDelete
  112. The Scriptwriter
    September 25, 2016 at 5:04 PM

    Dear Capt,
    Consider it done.
    For 800 years We Indians didn't have the right leaders. But we have now and his name is Capt Ajit Vadakayil. The young generation looks up to you and the wisdom you share!
    Jai Hind!
    Delete

    #########################
    Capt. Ajit Vadakayil
    September 25, 2016 at 8:21 PM

    WARNING-

    CAPT AJIT VADAKAYIL DOES NOT DISH OUT ANY DOGMA

    ALL I DO IS TO GIVE INFORMATION

    IT IS UP TO MY READERS TO ACCEPT IT -- BY USING THEIR PERCEPTION , COMMONSENSE AND CONSCIENCE.

    EXAMPLE--

    POL POT IS CONSIDERED AS THE WORLDs MOST EVIL PERSON

    I GAVE INFORMATION ON POL POT--

    IT IS UP TO YOU-- TO DECIDE

    I CLAIM NO CREDIT WHEN YOU USE YOUR FREE WILL.

    THE REASON WHY I COMMANDED VERY GOOD SHIPS WAS -MY CREW FELT THAT EVERY DECISION OF MINE ( HOWEVER HARD ) WAS THEIR OWN. THEY MADE IT HAPPEN- NOT ME.

    http://ajitvadakayil.blogspot.in/2015/11/pol-pot-of-khmer-rouge-great-cambodian.html

    DOGMA AND HUMAN FREEDOM CANNOT CO-EXIST.

    TO CEASE INTELLECTUAL ACTIVITY IN THE BRAIN, ALL YOU HAVE TO DO IS INJECT DOGMA. .

    DOGMA IS OTHER PEOPLEs THINKING --NOT YOUR OWN PROCESS .

    WHEN DOGMA DIES , MORALITY TAKES BIRTH . . .

    SANATANA DHARMA UNDERSTOOD THIS -- ALL GLORY TO SANATANA DHARMA .


    capt ajit vadakayil
    ..

    ReplyDelete
  113. Hello Captain,
    What do you think if vatican might have stored some of our Indian archives?
    And they don't want to return the archives, as we can do the genesis & research and will lead the world.

    ReplyDelete
  114. Atish Awasthi
    September 27, 2016 at 6:30 PM

    would you please throw some light on kainchi dham temple is it real or fake please if you have any information about it.i shall be thankfull to you.

    ################################

    Capt. Ajit Vadakayil
    September 27, 2016 at 7:09 PM

    hi aa,

    JEW ROTHSCHILD CREATED SEVERAL GODS AND GURUS

    ONE WAS NEEM KAROLI BABA

    ALL THIS STORIES ABOUT THE RAILWAY STATION AT NEEB KAROLI IS BULL PROPAGATED BY ROTHSCHILD MEDIA. THAT HE IS AN AVATAR OF HANUMAN.

    NEEM KAROLI BABA WAS USED TO PROPAGATE HANUMAN AS A POWERFUL BRAHMACHARI GOD AND THIS HELPED THE DEVADASI INFLUX INTO "COMFORT HOUSES " FOR WHITE BRITISH TROOPS

    HIS ASHRAM HAD A DAILY RECITATION OF HANUMAN CHALISA

    Naive devotees stayed for 100 days at the ashram --because Neem baby assured that any person who chants the Hanuman Chalisa 100 times daily for 100 days will get MOKSHA. ( verse 38 ).

    NEEM BABA KAROLI GAVE PROPAGANDA THAT EVERY LINE IN AWADHI OF HANUMAN CHALISA IS MORE POWERFUL THAN GAYATRI MANTRA.

    hindus stopped reciting SANSKRIT MANTRAS and switched over to AWADHI mantras.
    http://ajitvadakayil.blogspot.in/2014/02/devadasi-system-immoral-lie-of-temple.html
    TODAY ROTHSCHILD MEDIA USES JEWS TO PRAISE NEEM KAROLI BABA.

    SOON MODI WILL GO TO USA TO UNVEIL A STATUE OF NEEM KAROLI BABA , PROBABLY AT FACEBOOK HEADQUARTERS OR STEVE JOBS APPLE HEAD QUARTERS

    TULSIDAS WHO WROTE HANUMAN CHALISA WAS A FAKE AND BACKDATED CREATION OF JEW ROTHSCHILD.

    IN THE WHORE HOUSES AT GRANT ROAD AND KAMATIPURA DEVADASI WHORES WHO WERE MARRIED OFF TO HANUMAN SANG HANUMAN CHALISA IN EXTREME DISTRESS. THEY WERE NOT PAID.

    THE WHITE TROOPS HAD FREE SEX. GIVING FREE SEX TO WHITE TROOPS MEANT THAT HANUMAN WILL BE HAPPY . .

    Gora singer Krishna Das spAke : “It goes far beyond Hindu mythology. To chant the ‘Chalisa’ is to acknowledge that we are suffering"

    Many gora devotees after having drugs claim that they say neem baby morph into a monkey--and all were mahaa impressed. Drug dealers made hay ..

    Every drugged gora devotee would be given a YELLOW BOOK of hauman chalisa with a monkey on the cover

    The propaganda was Tulsidas was also an avatar of Hanuman

    Here is Krishna DAS baby-- giving BULL

    https://www.youtube.com/watch?v=m946LhDQcoU

    capt ajit vadakayil
    ..

    ReplyDelete

  115. sai
    September 28, 2016 at 10:36 AM
    Guruji,
    you told about healing properties of Gaga long ago and now scientists are agreeing

    http://indianexpress.com/article/india/india-news-india/imtech-microbiologists-find-healing-properties-in-ganga-water-3047654/

    Thank you
    SK

    ReplyDelete
    Replies
    #############################
    Capt. Ajit Vadakayil
    September 28, 2016 at 10:43 AM

    THIS BLOGSITE HAS MADE MORE THAN 10,000 REVELATIONS MOST ARE IN THE INVENTION/ DISCOVERY PLANE ( NOT OF INNOVATION )

    ALL WILL BE PROVED TRUE --

    REASON ?

    MOST REVELATIONS COME FROM MY GENOME -- WHICH IS NOT PERCEPTION OR CIRCUMSTANTIAL EVIDENCE

    http://ajitvadakayil.blogspot.in/2014/06/ganga-manthan-cleaning-of-river-ganges.html

    capt ajit vadakayil
    ..

    ReplyDelete
  116. This comment has been removed by the author.

    ReplyDelete
  117. TODAY TIMES OF INDIA HAS A POLL

    "Salman Khan says Pakistani actors are artists, not terrorists"

    CLICK ON AGREE/ DISAGREE

    THIS IS HOW ROTHSCHILD MEDIA CONVERTS SUNRISE TO SUNSET

    THE CONTEXT CHANGES-- BEFORE URI AND AFTER URI ATTACK

    INDIANS ARE NOT FOOLS--57% HAS DISAGREED

    CONTEXT MEANS EVERYTHING

    CONTEXT IS THE KEY TO UNDERSTANDING

    IN THIS MODERN WORLD OF CHOICE-- CONTEXT --NOT CONTENT IS KING

    WITHOUT CONTEXT WORDS AND ACTIONS HAVE NO MEANING

    I ASK MODI TO EXPLAIN THIS TO HIS MINISTERS. ANYBODY TRYING TO PUT CONTEXT IN FOG ESPECIALLY WHEN THE NATION IS UNDER ATTACK --MUST FEEL THE PAIN . .

    ONLY THIS BLOGSITE CAN EXPLAIN ALL THIS . . THIS IS WHY CAPT AJIT VADAKAYIL IS THE NO 1 WRITER ON THIS PLANET.

    CHRISTIANS AND MUSLIMS HAVE ALWAYS TAKE THEIR HOLY BOOK OUT OF CONTEXT TO SCREW THIS PLANET

    WITHOUT CONTEXT ANY PRICE OF INFORMATION IS JUST A DOT . .. KNOWLEDGE IS INFORMATION IN CONTEXT SO THAT WE CAN CONNECT THE DOTS USING OUR FREE CHOICE

    MANY TIMES QUOTE FROM FAMOUS MEN OF ETHOS HAVE BEEN TAKEN OUT OF CONTEXT. . .GANDHI USED TOLSTOY OUT OF CONTEXT TO MAKE INDIANS SLAVES

    MEANING IS CONTEXT BOUND

    DONT COME NEAR ME ( I HAVE JUST FARTED )

    EVIL MEN ONLY SAY-- SEE CAPT AJIT VADAKAYIL TOLD US TO KEEP AWAY FROM HIM . THE CONTEXT IS OF FARTING AND THE MESSAGE WAS POSITIVE

    I ASK THE LAW MINISTER TO EXPLAIN CONTEXT TO OUR STUPID JUDICIARY. THESE MELORDS NEVER GET ANYTHING IN CONTEXT.

    SO JUSTICE IS BLIND ? IT IS BECAUSE CONTEXT IS DELETED-- THE MORE TIME A CASE TAKES TO BE RULED-- THE MORE THE CONTEXT DISAPPEARS .

    KARNATAKA WANTS WATER TO DRINK--TAMIL NADU WANTS WATER FOR WATER INTENSIVE SUGAR CANE CROPS TO MAKE PETROL/ FUEL.

    SO WHAT IS THE CONTEXT ? . EVEN A RETARDED CHILD CAN FIGURE OUT . .

    BEING MISQUOTES AND TAKING THINGS OUT OF CONTEXT IS DIFFERENT.

    IF CONTENT IS KING- CONTEXT IS GOD

    WHY IS THIS PLANET SO FUCKIN' STUPID ? . SO MANY INNOCENT MEN HAVE BEEN HUNG BY JUDGES , WHO DONT HAVE THE CEREBRAL WHEREWITHAL TO UNDERSTAND THE CONTEXT..

    THIS IS WHY LAWYERS TUNED JUDGES MUST GO--

    PERCEPTION MUST BE RULED BY CONTEXT.

    HAVE YOU SEEN HOW STUPID YANK LAPD READS OUT YOUR RIGHTS-- YOU HAVE THE RIGHT TO REMAIN SILENT BLAH BLAH FUCKIN' BLAH

    BLOODY CUNTS !

    capt ajit vadakayil
    ..

    ReplyDelete
  118. the WAHABBI/ SALAFI brainwash is - - -

    LIFE ON EARTH IS JUST A BRIDGE TO ATTAIN ETERNAL JANNAT ( ENDLESS BLISS IN HEAVEN WITH 72 VIRGINS )

    MARTYDOM FOR ALLAH BY KILLING NON-BELIEVERS SACRIFICING YOURSELF IN THE PROCESS --IS THE GOAL OF EVERY MUSLIM AS PER "SHIRK" SALAFI/ WAHHABI CRYPTO JEW PREACHERS ( LIKE LIKE HINDUS SAY MOKSHA BY GOOD KARMA IS OUR GOAL )

    IF THIS CAN HAPPEN IN A LITERATE STATE LIKE KERALA, GOD SAVE INDIA

    EVERY "SHIRK" PREACHER MUST BE PROFILED- THE GOVT MUST START DOSSIERS , RIGHT NOW

    ISIS WAS CREATED , ARMED AND FUNDED BY JEWS -- THE RECRUITMENT PROPAGANDA WAS HAJAAR SEX IN JANNAT WITH 72 VIRGINS!

    THERE IS NOTHING LIKE THIS IN KORAN . .

    AL SAUD IS A CRYPTO JEW RACE INSTALLED BY JEW ROTHSCHILD ON SAUDI THRONE.


    The number 72 applied to a good man deserving heaven.

    Like in Hinduism a Jivan Mukt ( who was buried and NOT cremated ) had a perfectly balanced BODY/ MIND / SPIRIT .

    This was possible by PRANA flowing free and pure through his 72 MAJOR nadis.

    "Through one of these, the Udâna leads us upward by virtue of good deeds to the good worlds, by sin to the sinful worlds, by both to the worlds of men indeed." (Prasna Upanishad Q3)- 5000 BC

    The TOP THREE being Shushumna , Ida and Pingala.

    I shall mention a few important nadis- Gandhari, Hastajihva, Kuhu, Saraswati, Pusha, Sankhini, Payasvini, Varuni, Alambusha, Vishvodhara, Yasasvin etc

    All of these 72,000 nadis do NOT have a physical manifestation--as they are meridian paths for energy..

    "A hundred and one are the arteries of the heart, one of them pierces the crown of the head. Going upward through that, one becomes immortal at death. Other arteries, going in different directions, only serve as channels for his departure from the body, ..." (Chandogya Upanishad -CU 8.6.6) 5000 BC

    These Nadis ( metaphysical meridians ) are kept primed by deep diaphragmatic breathing and by following the laws of the Universe.

    Surah Al-Waqia (56:35-37) of the Quran describes the houris as "most refined", created by Allah "in the best of form" and well-matched". This has NOTHING to do with deviant sex.


    Let me quote some POISON INJECTED ( by Jews ) Hadiths.

    The Jews have injected so much poison into Hinduism that this is just 0.001%.

    "The believer will be given such and such strength in Paradise for sexual intercourse".

    "The penis of the Elected never softens" and that men in heaven will have the sexual strength of 100 men"

    “Appetizing vaginas- non-menstruating / non-urinating/ non-defecating/ untouched / with hymen unbroken by sexual intercourse”

    “ Every male admitted into Paradise will be given eternal erections and wed to 72 wives, all with libidinous sex organs”

    “ Full breasted / large, round breasts which are not inclined to hang".


    “ Would not urinate, defecate, become pregnant or menstruate. Hairless except the eyebrows and the head"

    “ Round about the believers will serve, to them, young boys, who will be as pearls well-guarded. They will be served by immortal eternal young boys ... as fair as virgin pearls “ ( FOR ANAL SEX )

    “The marrow of the bones of their legs will be seen through the bones and the flesh."

    Jews have compared HOURI to WHORE.

    The number 72 comes only in the Hadith -- which has been poison injected by Jews --out of shape.

    http://weaselzippers.typepad.com/blog/2009/09/video-saudi-cleric-extols-the-virtues-of-allahs-virgins-in-paradise-they-are-white-women-who-are-men.html

    72 number is NOT there is the ORIGINAL FIRST WRITTEN Koran at Cheraman Perumal mosque by Namboodiri convert Malik Deenar and party.

    THE EDUCATED MUSLIMS OF INDIA MUST SAVE ISLAM . . .

    TODAY 99% OF MUSLIMS CHOLARS ARE FAKE --MOST OF THEM IN THE PAYROLL OF JEWS . . .

    even hafeez saeed has his ZEBIBA mark in the wrong place . . . .

    http://ajitvadakayil.blogspot.in/2011/07/cracked-heels-and-prayer-marks-capt.html

    capt ajit vadakayil
    ..

    ReplyDelete
  119. Rahul menon
    October 18, 2016 at 10:44 AM
    Hello Sir,

    I came across an article The ‘Center of the universe’ located in Tulsa has an incredible acoustic anomaly that seems to defy the laws of physics..

    http://www.tulsaworld.com/weekend/music/what-is-tulsa-s-center-of-the-universe-landmark/article_9b843716-a654-54d4-8591-f29dc7fd5513.html


    What can be the real reason to this?

    ReplyDelete
    Replies
    #####################
    Capt. Ajit Vadakayil
    October 18, 2016 at 11:19 AM

    hi rm,

    THIS IS ACOUSTIC SCIENCE

    JUST OVER THE WALL OF MY PREVIOUS HOME IS CALICUT , WE HAD THE SCIENCE PLANETARIUM

    THERE THEY HAVE A CONCAVE SURFACE WHERE OF YOU WHISPER THE SOUND CARRIES LIKE A TELEPHONE WITHOUT WIRES.

    THIS IS SCIENCE

    INDRAPRASTA HALL BUILT BY MAYA DANAVA WAS FULL OF SUCH MAGIC ( REAL ACOUSTIC SCIENCE )

    WHEN DURYODHANA FELL IN THE THE POOL . DRAUPADI STOOD IN AMBUSH IN SUCH A CONCAVE FOCUS AREA AND WHISPERED " ANDHASYA PUTR ANDAHAH " THE SON OF THAT BLIND MAN IS BLIND TOO.

    THIS WAS ALLUDING THAT HIS FATHER KING DRITARASHTRA IS BLIND AND HIS MOTHER GANDHARI TOO HAD BLINDFOLDED HERSELF --BLIND PARENTS

    THERE COULD BE NO GREATER INSULT TO A GUEST KING

    THIS WOULD BE THE ROOT CAUSE OF MAHABHARATA WAR 6000 YEARS AGO.

    SOMETIMES MENTAL BLEEDING HURT MORE THAN ACTUAL BODY BLEEDING

    HINDU LTTE TOOK BIRTH ONLY BECAUSE SRI LANKAN BUDDHIST SOLDIERS SPRAYED AERATED SHIT ON TAMIL VILLAGES USING HELICOPTERS .

    LATER THIS LTTE MOVEMENT WAS HIJACKED AND HINDU PRABHAKARAN BECAME BRO PIRBHAKARAN AND HE NAMED HIS SON CHARLES

    LTTE SOLDIERS SPLIT AS THEY WOULD NOT AGREE TO BE BURIED , RATHER THAN BE CREMATED

    http://ajitvadakayil.blogspot.in/2012/08/aidmk-dmk-misplaced-support-for-ltte.html

    THIS WILL REMAIN THE MOST EFFECTIVE HEGELIAN DIALECTIC IN HISTORY--UNLESS WE DO SOMETHING LIKE THIS IN KASHMIR , BALOCHISTAN , NW FRONTIER AND SIND

    UNLIKE WHAT PEOPLE LIKE HYPER PATRIOT GEN ROY CHOUDHURY THINK -POLITICIANS WIN AND LOSE BATTLES

    CHANAKYA CONVERTED HIMSELF FROM ACADEMICIAN TO POLITICIAN

    HE WAS THE ULTIMATE POLITICIAN-- HE CAN NEVER EVER BE SURPASSED.

    HE CREATED AND MENTORED HIS OWN KING. THIS KING WOULD RULE THE WHOLE OF INDIA EXCEPT NAMBOODIRI CHANAKYAs HOMELAND OF KERALA

    http://ajitvadakayil.blogspot.in/2014/08/chanakya-taxila-university-professor.html

    THE MAP BELOW IS WRONG-- THE EASTERN COAST OF TAMIL NADU WAS UNDER THE RULE OF MAURYA EMPIRE.

    http://www.newworldencyclopedia.org/entry/Maurya_Empire

    BANGALORE , PALANI OF YAZIDIS ( BUILT BY CALICUT KING CHERAMAN PERUMAL ) AND SRINGERI MUTT WERE ALL PART OF THE ANCIENT CHERA EMPIRE.

    CHERA EMPIRE WAS THE RICHEST AND MOST BEAUTIFUL PART OF THIS PLANET. NOBODY DARED ATTACK IT, BECAUSE OF OUR KALARI TRADITION.

    PUNJABIS AND MARATHAS HAVE WIND IN THEIR EARS—THEY HAVE NO IDEA WHO A KERALA KALARI WARRIOR WAS.

    http://ajitvadakayil.blogspot.in/2011/12/kalaripayattu-oldest-and-deadliest.html

    FRENCH ROTHSCHILD GAVE ROCKETS AND LONG RANGE GUNS TO JEW TIPU SULTAN - AND THIS WAS THE FIRST TIME NORTH MALABAR WAS CONQUERED.

    THE CALICUT KING ZAMORIN COMMITTED SUICIDE OUT OF SHAME WHEN HE LOST THE BATTLE TO TIPU SULTANs FATHER JEW HYDER ALI -- HE BLEW HIMSELF UP

    https://farm1.staticflickr.com/70/175687868_e857872cc2_z.jpg

    ABOVE MANACHIRA POOL OF CALICUT WAS THE PLACE WHERE ROYAL WOMEN OF ZAMORIN FAMILY TOOK BATH . THIS IS THE CENTRUM OF CALICUT.

    capt ajit vadakayil
    ..

    ReplyDelete
  120. Rn Murthy
    October 18, 2016 at 2:30 PM

    Dear Capt Ajit sir,

    What's the qualities of Brahmarishis ? Who can judge and declare them after a test or something ? Recently Mohanji Namboothiri was conferred the Brahmarishi title by Avadhutha Nadanandaji in Kurnool as below...https://www.facebook.com/MohanjiOfficial/photos/ms.c.eJxFktmRBDEIQzPa4jbOP7F1o7H8~_0oIcahukxbd0rGX1p9~_YO0VA0p~;oPdaqZUSVxHygXiKilH4ugrR0HatB2xK9ibor0sbFSpTkk1gUDhBjUcnwZ6SoKk5ABVW4yFX0QsgCaq~_EhO7JY6kRVMPgEUP7MOCADn6lawBfhe0KwcIZ3GUGEsCbRlsp8wZ3rSZAMJDGQ5F04RHvOESd~_FtW0dh16MTlwueoWdB6~_1025dUFj22AnAfOcOZMseZ~;~_si95TdGL9~;ihaZQ0klAYZzDoeni~;t0508num8hmGn9bv0ARNcHGmBdgHdY7x32fHKqXgVe23~_vrSqzQve7whbHXYTR3QGMHrN1T5Ykoiej5yzIownmYeTlKP1Ma3H802E82KUCilcyw1Vx~;OoxFbadP7X9NrZgajRtgYLBsCB~;wfY8zDn~;D5yfnrZuBMhxX~;uAhOLmUEUJ26qNqS2aWk2OoMLhwVnUMcvr4j3A5R~;2cvql.bps.a.1192078487516553.1073742005.131411020249977/1192080260849709/?type=3&theater
    What is the main purpose and duties/work of Maharshis ?

    ReplyDelete
    Replies
    ##################
    Capt. Ajit Vadakayil
    October 18, 2016 at 3:20 PM

    MOHANJI BELONGS TO ROTHSCHILDs FAKE DATTATREYA /NATH SECT

    ALL THE FAKE GURUS CLAIM STRENGTH FROM "HIMALAYAN MASTERS"-- SO EAAJJJY

    Mohanji baby started receiving guidance from Shirdi Sai Baba, Mahavatar Babaji, Sathya Sai Baba, Agastya rishi - AIYOOOOOOOOOOOOOOOO !

    HIS SECOND WIFE BIBA MOHAN IS BOSS OF ACT FOUNDATION

    http://www.theactfoundation.co.uk/content/apply-grant-charity

    HERE IS SOME UNADULTERATED BULL

    QUOTE : In February 2007, Mohanji was at an ashram in Kerala, when he was overcome by an unexplained sickness and nausea. So the swami of the ashram took him outdoors for a walk in the fresh air. They walked up to a house, about 500 yards away, went inside, and just as Mohanji sat on a chair, he lost his physical consciousness, slipping into deep samadhi. Sacred ash (vibhuti) started pouring out through the top of his head, slowly falling down his body. In the Dattatreya tradition, they say that sacred ash gushing out of the sahasraara (the head chakra), is a sign that the last remnants of karmas are being exhausted. Along with the vibhuti, he became incandescent, a bright light glowing from within him, radiating through his body and clothes. His body seemed transparent, his eyelids turned golden and his consciousness expanded beyond description. He felt everything was within him. UNQUOTE

    MOHANJI BABYs SECOND WIFE BIBA DEVI IS TOUTED AS PARVATI-- SO MOHANJI BABY MUST BE SHIVA , RIGJT?

    MOHANJI BABY DOES NOT SAY THAT HIS SECOND WIFE IS SERBIAN JEWESS BILIJANA RADONIC ( BIBA MOHAN ) DEVI . .

    THIS WHITE WOMAN ACTED IN THIS MARATHI MOVIE BELOW- - -

    https://www.youtube.com/watch?v=j7YIvIUk1ro

    BILIJANA RADONIC BABY WORKED IN SRI SRI RAVISHANKARs DUBAI BRANCH.

    I KNOW SOMEONE WHO LEARNT SALSA DANCING FROM HER--THE LEAST I SAY THE BETTER NOW.

    I KNOW THE BOSS OF MOHANJI BABY --AT A SHIPPING AGENCY AT OMAN.

    WHEN ROGUES BECOME SHIVA AND PARVATI ( A GORI ) GOD SAVE HINDUISM.

    I HAVE ENOUGH MASALA TO SEND MOHANJI BABY IN JAIL FOR MASS PUBLIC DECEIT AND MANY OTHER SECTIONS OF IPC -

    NAKLI INDIAN SHIVA AND SERBIAN PARVATI ARE UNDER THE SCANNER.

    capt ajit vadakayil
    ..

    ReplyDelete
  121. https://www.youtube.com/watch?v=sNv2l7HsZBk

    HERE IS SAGARIKA GHOSE ON BURHAN WANI . .

    https://twitter.com/sardesairajdeep/status/699641761203773442

    HER HUSBAND RAJDEEP SARDESAI SAYS --PATRIOTISM IS THE FIRST REFUGE OF THE SCOUNDREL

    WHY IS THIS COUPLE NOT IN JAIL- FOR INSULTING OUR PATRIOTIC JAWANS?

    OF COURSE WE KNOW THIS DESH DROHI COUPLE IS PRAYING DAILY TO KEEP MODI SAFE AND TO ASK GOD THAT WE DONT HAVE A WAR WITH PAKISTAN

    THEY KNOW WHAT CAN HAPPEN WHEN THE FLOOD GATES OF EMOTIONS OF INDIANS DESH BHAKTS OVERFLOW.

    WHEN A PATIENT DESH BHAKT , LAW ABIDING HINDU LOSES HIS PATIENCE --HISTORY IS WITNESS HOW RIVERS OF BLOOD FLOW.

    THE LIKES OF WHICH THIS PLANET HAS NEVER SEEN.

    capt ajit vadakayil
    ..

    ReplyDelete
  122. PEOPLE IN KERALA DID NOT EAT WHEAT BECAUSE OF GLUTEN.

    TODAY GM WHEAT IS TOXIC AND INCREASES PROFIT FOR EVIL PHARMA.

    EVIL PHARMA OF ROTHSCHILD HAS NOW SHIFTED TO INDIA, SO THAT THEY CAN USE INDIANS AS GUINEA PIGS

    THE CRYING BOLLYWOOD SUPERSTAR WAS PRAISING CHEAP UNTESTED GENERIC MEDICINES ( SHOW SPONSORED BY ROTHSCHILDs AXIS BANK ) -- AND CAPT AJIT VADAKAYIL HAD OBJECTED .

    MANY RICH PEOPLE GOT TERRIBLY UPSET.....

    ANYWAYS -

    THE JUDICIARY AND THE HEALTH MINISTRY HAS TAKEN NOTE AND SOME PEOPLE ARE IN JAIL.

    http://ajitvadakayil.blogspot.in/2012/05/guinea-pigs-for-untested-medicines.html

    THE POST BELOW WAS THE REASON, THE INDIAN GOVT BANNED SOME COMBINATION MEDICINES.

    WHY DOES IT TAKE A BLOGGER-- A RETIRED SHIP CAPTAIN TO WRITE ALL THIS ?

    PRIMARILY I WROTE THIS POST BELOW TO SAVE AN EMINENT SURGEON , WHEN HIS OWN BIRAADRI AND BROTHER HOOD ABANDONED HIM

    http://ajitvadakayil.blogspot.in/2014/11/sterilisation-deaths-of-13-tribalwomen.html

    http://www.catchnews.com/health-news/govt-bans-344-common-use-drugs-and-it-s-good-news-for-your-body-1458204790.html/fullview

    the above is one of the SUCCESS STORIES of this blogsite

    ZIONIST JEW OWNED AND BENAMI INDIAN FAKE OWNER RUN EVIL PHARMA WILL SOON FIND, MANY OF ITS AGENTS IN JAIL.......

    HAVE YOU SEEN HOW ROTSHCHILDs AGENTS LIKE BILL GATES AND PRINCE CHARLES RUNS TO PUNE SERUM INSTITUTE, AS IF THAT IS THE TAJ MAHAL ?

    capt ajit vadakayil
    ..

    ReplyDelete
  123. https://twitter.com/narendramodi/status/802030306823806976

    NARENDRA DAMODARDAS MODI DOES NOT EVEN KNOW HOW THE INDIAN CONSTITUTION TOOK BIRTH

    WHY DOES THIS GUJARATI FELLOW MODI THINK THAT THE INDIAN CONSTITUTION IS THE BRAINCHILD OF BR AMBEDKAR ?

    It was a sheer copy of the British model, just amended to suit India-- a draft given to Ambedkar on the quiet by JEW Rothschild.. There was NIL brainwork involved.

    Why don't you compare the two constitutions. Where is the intelligence, in copying and plagiarism?


    Dr B. R. Ambedkar was just the Chairman of an eminent team consisting of K M Munshi, Alladi Krishnaswamy Iyer, N Gopalaswami Ayengar , Madhava Rao , Md. Saadullah , TT Krishnamachari and a constitutional advisor Sir Benegal Narsing Rau .

    The separation of powers among the major branches of government, the establishment of a supreme court was copied from the US model, provided by Rothschild.

    PATHETIC !

    like THIYYAS ( ruling class for millenniums ) of kerala MAHARS were demoted by Jew Rothschild-- using BR Ambedkar's grandfather

    http://ajitvadakayil.blogspot.in/2015/10/the-only-dalit-freemason-of-india-capt.html

    http://ajitvadakayil.blogspot.in/2012/08/cnn-ibn-poll-greatest-indian-since.html

    TODAY MOST OF THE STUDENT LEADERS OF BR AMBEDKAR UNIONS ARE IN THE PAYROLL OF JEW ROTHSCHILD.

    QUOTA IS THE REASON WHY THE MOST BRILLIANT INDIAN STUDENTS GO ABROAD --

    NO LION WANTS TO COMPETE WITH MICE

    MERIT MUST RULE IN INDIA.

    capt ajit vadakayil
    ..

    ReplyDelete
  124. Div
    November 28, 2016 at 10:43 AM

    http://www.younews.in/pictures/indians-rank-high-in-believing-they-live-in-the-best-country-in-the-world-/?utm_source=dlvr.it&utm_medium=facebook

    #################


    Capt. Ajit Vadakayil
    November 28, 2016 at 10:55 AM

    INDIA IS THE HAPPIEST COUNTRY ON THIS PLANET

    INDIA HAS THE LEAST DIVORCE, RAPE , CRIME , HOMOSEXUALITY BY PERCENTAGE ON THIS PLANET.

    INDIA HAS THE BEST TOP SOIL ON THIS PLANET FOR FOOD WHICH PREVENTS DISEASE--THOUGH NOW DECIMATED BY THE "GREEN REVOLUTION " , "WHITE REVOLUTION"

    -- AND NOW ROTHSCHILD BRANDED APCO MODI WANTS "BLUE REVOLUTION"

    INDIA IS THE PLACE WHERE SOULS TAKE THEIR FINAL RIDE TO THE SEVENTH ASTRAL LAYER FOR MOKSHA -- FOR THE SOUL TO MERGE BACK WITH THE MOTHER FIELD.

    I HAVE SEEN THIS PLANET FOR 40 YEARS -- I HAVE EXPERIENCED THIS PLANET

    BALLS TO ROTHSCHILDs MEDIA AND THEIR COMMIE HISTORIANS

    capt ajit vadakayil
    ..

    ReplyDelete
  125. raj
    December 2, 2016 at 5:05 PM

    http://indianexpress.com/article/explained/how-and-why-delhi-high-court-revoked-ban-on-344-popular-drugs-4406154/

    ReplyDelete
    Replies
    ########################

    Capt. Ajit Vadakayil
    December 2, 2016 at 6:26 PM

    THIS IS WHY WE HAVE TO ABOLISH THE COLLEGIUM JUDICIARY.

    THESE LOSER LAWYERS TURNED ME-LORDS HAVE BEEN SAVING EVIL PHARMA AGAIN AND AGAIN AND AGAIN

    IT IS PATHETIC THAT A BLOGGER HAS TO WRITE THE POST BELOW--

    http://ajitvadakayil.blogspot.in/2014/11/sterilisation-deaths-of-13-tribalwomen.html

    OUR ELECTED EXECUTIVE UNDER MODI IS TOTALLY NAPUNSAK

    THEY HAVE LET DOWN PEOPLE WHO HAVE ELECTED THEM

    THE LAW MINISTER DOES NOT KNOW HIS JOB. HE IS CONTENT BEING A CHAMCHA OF MODI

    HIS SISTER ANURADHA IS MARRIED TO HALWAI RAJEEV SHUKLA OF BCCI

    WHAT DO YOU EXPECT FROM RAVI SHANKAR PRASAD ?

    capt ajit vadakayil
    ..

    ReplyDelete
  126. http://www.inquisitr.com/3764223/stephen-hawking-warns-humanity-about-donald-trump-we-are-at-most-dangerous-moment-in-history-video/

    CAPT AJIT VADAKAYIL DECLARES

    STEPHEN HAWKINGS HAS DONE NOTHING FOR THIS PLANET .

    HIS USELESS THEORIES ARE HYPED UP BY JEW ROTHSCHILD-- JUST BECAUSE HE SUPPORTS PEA BRAIN JEW ALBERT EINSTEIN--A THIEF

    http://ajitvadakayil.blogspot.in/2014/08/yellapragada-subbarow-nobel-prize-and.html

    ALL OF JEW EINSTEINs MATH WAS OUTSOURCED TO INDIA..

    http://ajitvadakayil.blogspot.in/2011/11/satyendranath-bose-nobel-prize-and.html

    A REAL GENIUS WAS NIKOLA TESLA

    HE INVENTED AC ELECTRICITY AND MOTORS

    TESLA MADE ON DENT ON THIS PLANET

    BEFORE THE INTERNET AGE , NOBODY HEARD OF TESLA

    MY FIRST BLOGPOST WAS ABOUT TESLA --TODAY MY BLOGPOSTS NUMBER 1090 .

    I HAVE COVERED ALMOST EVERY SUBJECT ON THIS PLANET .

    I AM TODAY THIS PLANETs NO 1 WRITER --IN QUANTITY, AS WELL AS QUALITY

    IF ANYBODY HAS WRITTEN MORE WORDS ON THIS PLANET , LET ME KNOW. ( INCLUDE ONE LAKH SEVENTY THOUSAND COMMENTS TOO )

    I GUESS I HAVE NIKOLA TESLAs BLESSINGS -- HE WAS DELETED BY JEW ROTHCHILD

    A THIEF NAMES EDISON WAS PUSHED AHEAD BY JEW ROTHSCHILDs HISTORIANS -- A SON OF A BITCH !

    http://ajitvadakayil.blogspot.in/2010/11/edison-ace-delegator-cum-patent.html

    capt ajit vadakayil
    ..

    ReplyDelete