Friday, July 22, 2016









atha yoganushasanam
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tatah pratyakchetanadhigamopyantarayabhavashch
tatpratishedhartham ekatattvabhyasah
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih


tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
sthirasukham aasanam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah


deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti


janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah
purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti















Respected Ajit Sir,

I would like to thank and express my gratitude to you for the work you have been doing for last 6-7 yrs.
I was introduced to your blogs by one of my friends and I am very much thankful to that guy as well.
I find your blogs very informative. Sometimes I also wonder about your source of great level of information and knowledge. But then I think it must be your 4 decades of experience at sea which is paying you off(I might be wrong in this judgement).
The great thing about your blogs is that while reading them my inner conscience asks me to believe their content.
Hence, whatever I am writing below is the voice of my inner conscience.

Since my childhood, I have been a staunch believer of Hinduism. I have read your blogs on Sanatana Dharama. Your blog series on Sanatana Dharam is truly a masterpiece of your writings.
Sir, I try to understand them deeply but somehow can get merely 2%-3% of what you write.
This must be due to my pea-brained level of understanding and the magnificence of this ultimate and the great concept which we know by the name of Sanatana.
But only 2%-3% of this understanding has developed in me an amazing feeling of great pride in being a Hindu and an Indian.
And this feeling is so strong that it would never ever fade away. I am VERY GRATEFUL to you for this.
I am proud to be born in a country whose culture is the greatest and richest on this planet. All our maharishis and sages were great scientists and masters of meditation. Their contribution to this country and society can never be matched.
My endeavour is to take my understanding of Sanatana Dharam to a much higher level. I would be very thankful if you can guide me with few ways in which I can do that.









    capt ajit vadakayil


Vande Gurunam Charanaravinde
Sandarshita Svatma Sukava Bodhe
Nih Sreyase Jangalikayamane
Samsara Halahala Mohashantyai

Abahu Purushakaram
Shankhacakrsi Dharinam
Sahasra Sirasam Svetam
Pranamami Patanjalim



I bow to the lotus feet of the Supreme Guru
which awaken insight into the happiness of pure Being,
which are the refuge, the jungle physician,
which eliminate the delusion caused by the poisonous herb of Samsara (conditioned existence).

I prostrate before the sage Patanjali
who has thousands of radiant, white heads (as the divine serpent, Ananta)
and who has, as far as his arms, assumed the form of a man
holding a conch shell (divine sound), a wheel (discus of light or infinite time) and a sword (discrimination).



Svasthi Praja Bhyaha Pari Pala Yantam
Nya Yena Margena Mahim Mahishaha
Go Brahmanebhyaha Shubamastu Nityam
Lokah Samastah Sukhino Bhavantu
Om Shanti Shanti Shantihi


May the rulers of the earth keep to the path of virtue
For protecting the welfare of all generations.
May the religious, and all peoples be forever blessed,
May all beings everywhere be happy and free
OM peace, peace,  peace

2.16 —  heyan duhkham anagatam

The grief which has not yet come may be avoided.

Past pain is over.  The pain being  experienced in the present cannot be avoided, but can be minimised to some extent by yogic practice and discriminative knowledge. Unknown future pains can be forestalled by cohering to yogic discipline now. Man is the only living creature who can control or change his life. He is not a slave to his surroundings or at the mercy of nature. There is nothing that wastes the body and mind like worry. Worries are more about yesterday and tomorrow. Don’t take tomorrow to bed with you.  There is a difference between planning and worrying. Planning is constructive, worry is destructive. The best time to solve a problem is as soon at it happens.Man has 3 sides to his nature –body, mind and spirit . A proper balance between the 3 is desired. If any of the 3 is undeveloped he will suffer in life. Without spiritual development , man is without love or positive emotions ( affection, care, respect, sympathy ) .  Without positive emotions man cant be happy. A wise man can live in peace with things he cannot change. Never try to do things you cant. What is the point in teaching a donkey to sing. It is a sheer waste of time and effort. Nature follows the law, use it or lose it. Make most of the best and least of the worst. Man alone is the architect of his destiny.  Inaction is worse than no action at all.Patanjali says that yoga is a preventive healing art, science and philosophy, by which one builds up robust healthy conditions in body and mind and constructs a protective strength with which to ward off or counteract afflictions that are as yet unperceived afflictions. Moreover, strong health and a stable mind will facilitate one to face the wonder of wonders - the spiritual bliss - if and when, thanks to the good actions in former lives, the spiritual gate is set open. According to the yogis, death doesn’t solve your problem any more than night fall solves your financial problems. Yogis claim that knowledge, bliss and Enlightenment can be attained here and now while still in this physical body.  This is attained by following a definite scientific approach which has been verified by the experience of innumerable yogis, saints and sages through the ages. Future suffering has its seeds in the present and the past. It is only through liberation that future suffering can be fully eliminated. Avidya (ignorance) which is at the root of all the kleshas that cause suffering. So, our objective in eliminating future suffering would be to uproot Avidya.  Faith and trust are the seeds which bring the sweet fruits of success. Faith is about “ can do”  think “ it is possible”  it gives you new energy. Will power is the decision to carry on the fight. Self esteem is required to make a person mentally healthy.  Faith is the bird which sings when the dawn is still dark. A mentally healthy person learns to evaluate himself , his own performance and behaviour. To be successful you must be exited about life. Life is a festival only to those who live with enthusiasm.   If you want peace you must be prepared for war—NOT sit like an idiot and spin the charkha .  Only a moron will  start digging a well, when he gets thirsty. It is not enough to aim, you must hit. Failure to hit the bulls eye is never the fault of the target. You have to choose your own goal, at the same time follow social norms. Belief in predetermined destiny is the only refuge of weak minds. Take responsibility for your failures. Laughter is the cheapest luxury, it electrifies the nerves and cleanses the system. Prayer renews our internal strength during rough weather. A prayer is to the soul what air is to the lungs. Yoga helps you to  forget useless things. To remember everything is to make your mind a dustbin.  There is NO medicine for jealousy except yoga. Jealousy is poison for the soul.   Yoga teached you that the greatest wealth is contentment with little. It consists in simple wants. Too much glamour is like too much spices. It harms. The blatant display of status symbols  is the result of low self esteem. The self confident person can afford to project a modest image. The purpose of life is not only to be happy, but also to be creative , productive and useful—to make a difference that you lived at all on this planet.  There is no experience better for the heart than to reach down and lift people. Only people with inferiority complex wants to impress others. Do not go around copying others signatures .There is no need to keep up with the Joneses. . All imitations are plastic. There is great joy in being ordinary.  Yoga helps you to eliminate the needless wants of life. As you can see yoga is NOT a physical exercise. You have succeeded in life when all you really want is only what you really need.  Never fall into the same hole twice. The first fall can be deemed as experience. Only what you experience is yours. If you have to look into the rear view mirror of life, just make it a darting glance. Do NOT dwell on it.  Yoga teaches that truth blossoms only in individual freedom. It can never happen to a crowd. If you surrender your freedom and individuality big brother and the society will give you great posts and respectability. Dare to be who you are. No order is higher than your own intelligence. You must allow life its freedom. All perfectionism is a deep ego trip. Most of your pain is self chosen. Creating guilt in you is the oldest trick of all religions.  Sanatana Dharma offers hope, not guilt—unlike the single holy book religions..

2.17 —  drashtridrishyayoh sanyogo heyahetuh

The cause of pain is the association or identification of the seer (atmi) with the seen (prakrti) and the remedy lies in their dissociation.

A prudent person notices that inner harmony is interrupted when the mind lets itself be lured into indiscriminately sampling the world of phenomena.  He tries to remain free by avoiding material attachment, in which objects attract the intelligence like a magnet and the self is tempted into an illusory relationship with the external, seen world, provoking pleasures and pains. The intelligence is the vehicle closest to the soul, which must be cautious of its influence if the seer is to stay free. Or else, intelligence entangles the seer into a painful relationship with external objects. As long as intelligence is indiscriminating, there is suffering. The moment it develops discriminative power, it realises its source, and unites with the seer. Then there is transparency between the seer and seen, allowing free, uncontaminated passage between them. The seat of the ego or small self is the seat of the brain, and the seat of the great Self is within the spiritual heart. Though intelligence links the head and the heart, it vacillates between the two. This vacillation stops through right knowledge and understanding. Intelligence is then transformed - free from polarity, pure and unbiased. This is true meditation, in which ego dissolves, allowing the great Self (purusa) to glimmer in its own glory.To uproot anything, we must get down to the root cause and eliminate that cause. This problem is linked to the origin of the universe wherein the consciousness, male purusha got entangled with elements of female Prakriti. This problem cannot be understood or analyzed by our limited intellect. It can and will be solved only through the transcendent knowledge that can be gained through enlightenment.  The key concept to remember is that the yoking of Purusha with Prakriti has taken place giving rise to bondage. Now we need to reach the state of liberation before fully eliminating all bondage, thus eradicating all suffering. The seer is Purusha who is the reflector of buddhi (the pure I-sense). The objects that are experienced by the buddhi are the knowable. The buddhi and the knowable, due to their proximity to Purusha, become an attribute of Purusha. Buddhi becoming the object of experience is revealed as the Purusha itself. This beginningless alliance between Purusha and the object of awareness (Prakriti represented by buddhi) is the cause of suffering which is avoidable. In the case of the union between Purusha and buddhi, it cannot be in space or time. Union in space is between two physical objects; union in time happens when two activities take place at the same time. The union between Purusha and buddhi is beginningless and is thus beyond time. The contact between the two is a peculiar union which cannot be distinguished by the senses. The union seems to occur only due to the I-sense (ahamkara) and can only be the result of ignorance since in reality these two are separate. Liberation from sorrow can only happen as a result of knowledge. The object or the knowable remains unmanifest unless seen by the observer. But it goes on mutating due to its inherent nature. As it is seen by the seer, it becomes the seer’s object and is thus dependent on the seer. Similarly to remove suffering we need to remove Purusha from its association with Prakriti. This sutra and several of the subsequent sutras constitute the essence of the Samkhya philosophy. These sutras clearly tell us that Samkhya and Yoga are essentially dualistic philosophies where Purusha and Prakriti are projected as two independent entities. Most people are aware that ‘yoga’ is derived from the root word ‘yuj’. The most commonly given meaning of ‘yuj’ is to join, unite or yoke etc. In that sense, most people tend to say that yoga is the ‘union of body, mind and soul’, without really understanding its true meaning. What we need to understand is that another meaning of ‘yuj’ (as per dhatupatha which is the source book of all root words in Sanskrit) is ‘samadhau’ (in samadhi) or ‘to concentrate the mind’.  In light of the sutra 2.17 which we are discussing here, it is clear that, in fact, the union between Purusha (soul) and Prakriti (mind-body complex) is indeed the cause of suffering and the cycle of birth and re-birth. It is only through un-uniting the two, that is, understanding the separation between Purusha (the seer) and Prakriti (the seen) that one can attain liberation. …

पुरुषः प्रकृतिस्थॊ हि भुङ्क्तॆ प्रकृतिजान्गुणान्
कारणं गुणसङ्गॊ‌स्य सदसद्यॊनिजन्मसु 21
Bhagavad Gita (13.21) 4000 BC

puruṣaḥ prakṛtistho hi bhuṅkte prakṛtijān guṇān
kāraṇaṃ guṇasaṅgosya sadasadyonijanmasu 13.2 

"Since the soul is seated in Nature, therefore it experiences the qualities born of Nature. Contact with the qualities is the cause of its births in good and evil wombs."

We keep Bhagawad Gita at the level of the lowest common denominator , the layman with average intellect. The REAL wisdom of Bhagawad Gita can be understood only by the super-intelligent. Understand Samkhya Vedanta , creation of cosmos, on a macro scale  below. This is the third template of Sanatana Dharma. In Hindusim we call the MALE- purusha and FEMALE- pragati. Sometimes for purposes of the Kundalini raise MALE is SHIVA and FEMALE is Shakti ( Parvati ).

4000 years ago Adi Shankaracharya wrote –
Shivah Shakthyaa Yuktho Yadi Bhavathi Shakthaha Prabhavithum
Na Chedevam Devo Na Khalu Kushalaha Sphandithumapi

Translation Verse No 1 : Shiva becomes capable of creating the Universe, only when united with Shakthi , but otherwise , He is incapable of even a stir.

Tanta is NOT perverse sex. In the Tantric cosmology, the whole universe is perceived as being created, penetrated and sustained by two fundamental forces, which are permanently in a perfect, indestructible UNION. These forces or universal aspects are called Shiva and Shakti. Tantric art has captured the images of the Purusha and his consort, Pragati, in ecstatic union.  This is NOT perverted sex. Purusha and Pragati is expressed as Shiva and Shakti in the same body 50:50 – this is NOT a she boy or a transgender .  It is a mindboggling,  intelligent concept. In Hinduism we have placed the female on a pedestal . No man can do a yagam if he is a bachelor or a widower. Purusha is the embodiment of pure consciousness, and Pragati as the embodiment of pure energy.  Both Shiva and Shakti are Consciousness---- Shiva is the changeless static aspect of Consciousness, and Shakti is the kinetic, active aspect of the same Consciousness. Through uniting with Purusha , Pragati gave form to his spirit and created the universe.(we are talking about CREATION OF THE COSMOS here- not street side sex  as figured out by small minds).When the insentient Prakriti comes in contact with the sentient Purusha , the universe evolves. Purusha symbolizes consciousness, the masculine principle. Pragati symbolizes the feminine principle, the activating energy.  The cosmos in all its manifestations, as an act of love.  The relationship between say- Shakti and Shiva is the dance of consciousness and energy experienced within each of us, regardless of gender. Shiva resides in the highest Sahasrāra Chakra and Shakti in the lowest Mūlādhāra Chakra. When Prakriti and Purusha unite in the Sahasrāra Chakra ( raising of Kundalini ) , knowledge, knower and the object of knowledge become one.  Sankhya thus is a theory of evolution and understanding the universe. Prakriti cannot be perceived, not because of its non-existence, but because of its subtlety. It is perceived in its effects. The eternal and indestructible union between Shiva and Shakti gives birth to the whole Macrocosm, in its stable, static aspect as well as in its dynamic one. Not only is Shakti responsible for creation, it is also the agent of all change. Shakti is manifested by Shiva only during creation and is withdrawn into himself at the end of creation. This is for the perceptive.  Shallow western minds have never understood this  amazing truth. Modern science repeats from our Vedas that matter and energy are interchangeable.  So does consciousness and energy .  In the highest planes they are interchangeable, which is why we see a great incongruence between our spiritual experiences and the external reality. In the higher metaphysical realms and subtle planes of our consciousness the physical laws of our universe lose their validity.  Samkhya as you can see was a masterpiece of modeling the ways of the inner universe.

Tayor yad yamalam rupam sa samghatta iti smrtah---
Ananda-saktih saivokta yato visvam visrjyati,
Na Sivah Saktirahito na Saktih Sivavarjita.  ---(Tantraloka-Ahnika, 3.)

"The coupled form of these two (Shiva-Shakti) is called junction.  That is called the blissful Shakti from which creation arises.

ADAM and EVE story is just lifted from our sanskrit upanishads -  this story is the basis of the Abrahamic religions Judaism/ Christianity / Islam. All three religions draw upon this STOLEN story from MUNDAKA upanishad III, 1, 1-3 ( Genesis of the Old Testament ).. This story and speaks of the tree of knowledge and God's commandment that its fruit shall not be eaten. Adam at first did not eat it but Eve did. After that Adam too ate the forbidden fruit. The upanishad ORIGINAL story is about two birds sitting on a peepal tree.   The birds are PURUSHA (atman )and PRAKRITI ( jiva )-- with purusha being the witness. HEY PRESTO--ATMAN becomes ADAM.  JIVA becomes EVE ( j is silent in most areas ) --people call me AIT ( ayit ) instead of AJIT. The FIG which eve ate is the fruit of the peepal tree ( FICUS ) -- the true botanical name today is FICUS RELIGIOSA.  The old testament NEVER spoke of apple ( from a fig tree ) !

2.18 -- prakashakriyasthitishilan bhootendriyatmakan bhogapavargarthan drishyam

Nature, its three qualities - sattva, rajas and tamas, and its evolutes, the elements, mind, senses of perception and organs of action, exist eternally to serve the seer, for enjoyment or emancipation.

The visible objective world consists of elements of nature and senses of perception comprising three qualities or attributes (gunas), which are illumination, motion or action, and inertia or dormancy. All these exist perpetually to serve the seer (the subject) for the purpose of experiencing the pleasures and infatuations (objects) of the world, or for emancipation. This sutra delineates the characteristics, actions and uses of nature (prakrti). The three attributes of nature are sattva, rajas and tamas.. According to Patanjali, sattva, rajas and tamas represent prakasa, kriya and sthiti. These attributes have their own virtues, for instance, prakasa or brilliance or splendour is sattva; kriya or study, investigation and action is rajas; and the essence of the being resting as sthiti or dormancy is tamas. That which is knowable has the nature of illumination, activity, and inertia (sattva, rajas and tamas). It consists of the senses and the elements, and exists for the purpose of (providing) either liberation or experience (to purusha). All these attributes and virtues are established in the elements of nature, senses, mind, intelligence and ego. Together they function tunefully in the form of illumination, action and inertia, allowing the seer to enjoy the world's pleasures (bhoga); or by divesting himself of them, to experience liberation.  The seer is enclothed with five sheaths (kosas), by the elements of nature - earth, water, fire, air and ether. Earth represents the anatomical, water the physiological, fire the mental, air the intellectual and ether the spiritual sheaths. The organs of action and senses of perception assist the sadhaka in cleansing the anatomical and physiological sheaths through yama and niyama. Asana, pranayama and pratyahara divests the seer of the mental sheath; dharana and dhyana cleanse the intellectual sheath. Samadhi brings the seer out through the shackles of all the sheaths to experience freedom and beatitude. The purpose of the whole of Nature is for purusha to gain experience.  At the beginning of evolution, Purusha comes in contact with Prakriti which disturbs the equilibrium state of the three gunas. The objective of yoga is to harmonize rajas and tamas back into sattva which needs to dominate before Purusha can realize it own true nature. This is self-realization. When self-realization is attained through a dominant sattva, the other two gunas are not ‘dead’. They are just not active; however, they can be called upon into action if the sattva so desires. So, for a realized person, the gunas are under the control of sattva and come into play when the consciousness is projected outward. In DVAITA Vedanta ( second template ) Rajas and Tamas are two opposite poles mediated by Sattwa ( TRINITY ) . Tamas and Rajas are opposing fields like positive and negative while Sattva is neutral. In Dvaita Hinduism opposite poles Tamas and Rajas are conscious of each other. Tamas creates Rajas, and Rajas activates/ excites Tamas. 7000 year old Vedas say that the only constant in the cosmos is change, everything is in a state of flux, nothing is static-- everything is vibratory.  This is what guarantees growth and evolution. It is a cosmic spiraling dance of  separate opposing forces, which sustains this universe. No life is possible on earth without this subtle tension . What has a front has a back-- what has a beginning has an end. Brahma / Vishnu / Shiva work in tandem and perfect harmony—amazing cosmic allegories personalized as Hindu Gods.   One cannot exist without the other and they are dependant .  No phenomenon in this universe is completely devoid of its opposite.  They consume each other yet support each other. Whatever is in excess gets reduces, whatever is deficient gets replenished. You must ponder over each waxing-waning cycle to appreciate the absolute truth . They keep each other in check, yet provide fuel to feed off each other. It is a perfect tango of dynamic balance where one polar opposite changes into another smoothly and constantly .  If the restraining balance or equilibrium is lost by the mediator ( Vishnu ) , the universe will spiral out of control and end. This is why Lord Vishnu is called the PRESERVER god.  As for the opposing forces TAMAS/ RAJAS ( Brahma/ Shiva ) it really does NOT matter as who is who, like in AC electricity-where you can plug into the socket both ways. This principle of Dvaita Hinduism -- Tamas Rajas , which are rooted together , is present in every phenomenon on earth.  Vedanta has recorded  7000 years ago, that energy transforms from one to another—it can neither be created or destroyed. These two opposing forces are natural and transform each other , in perfect harmony.  Harmony can never be stagnant .  Lessening of Tamas always results in increase of Rajas and vice versa. Balance can never be permanent— Tamas and Rajas continiously devour each other – and life flows on. Tamas influences Rajas not only from inside but also from outside.. they are rooted together.  Tamas and Rajas are connected through consciousness.  It is about the quantum possibility wave vibration between two poles.  Ancient Vedic Indian rishis  firmly believed that the invisible below the quantum screen gives rise to the visible.  So either Tamas or Rajas is visible – never both. Together the TRINITY  - THE SECOND TEMPLATE express the supreme BRAHMAN  - THE BASE TEMPLATE at absolute peace with itself. This universe cannot exist without vibrations between two poles. To the spiritual eastern mind, the story of SAMUDRA MANTHAN produces amazing acts of faith like the Kumbh Mela , which has been going on for 6000 years. The Devas Asuras doing pull and push is represented by Samudra manthan, where mount Meru is used to churn the oceans for Amrit  ( Ambrosia ) in a to and fro movement , representing vibrations- by 54 Asuras and 54 Devas making the number divine Hindu number 108 rooted in Sri Yantra ( 54 triple intersections ) . The purpose of the phenomenal world is to provide an experience which helps in the growth and perfection of the individual centers of consciousness. The final role of the phenomenal world is to provide liberation for the Purusha. It is only through the experiences provided by the bhutas and indriyas that the evolution of consciousness can unfold until final liberation happens. Sattva is sentience – knowing (for a subject or organs of knowledge) or capable of being known (for an object of Prakriti); rajas is mutability – all forms of movement and action; tamas is inertia – latencies and retention. Thus, all internal and external worlds are made up of the three gunas – sattva, rajas and tamas. A knowable or an object is that which needs association with Purusha for being revealed. The elements (bhutas) and the organs (indriyas) constitute the entirety of the world of objects. For the Seer (Purusha), the seen (drishya) has two purposes – that of providing experience of pleasure and pain, and of liberation. Liberation implies that the seer realizes that it is not an object or knowable but is separate from all knowables (drishya or Prakriti). Everything, internal or external, is an aggregate of the three gunas. Pleasure and pain are characteristics of buddhi (intellect). Happiness etc are the objects of experience by the Purusha. Pleasure and pain are a result of the reflected consciousness of Purusha. Giving up both pleasure and pain leads to final liberation. Witnessing of and identification with the experience is called bondage whereas witnessing the buddhi in liberation is called freedom (kaivalya). Yoga enumerates these basic functions of the inner instruments which are the result of the joint action of the mind and the senses: reception, retention, recollection, elimination, conception, and determination. These six are present in all states of a fluctuating mind. When the fluctuations of the mind stop, these six also come to a stop. As long as the world is manifest, the three gunas are always in flux. They assert themselves in various proportions, giving rise to ever-changing world of manifest forms. The purpose of the gunas is to provide either experience of liberation for the purusha. Experience consists in pursuing pleasure and avoiding pain while liberation entails realization by purusha of its own true nature. Bondage is the false identification of purusha with the buddhi. Liberation is the uncoupling of purusha from the buddhi. When the buddhi is impure due to the dust of rajas and darkness of tamas, it does not discriminate between the seer and the seen. When the buddhi is purified, the natural illumination of sattva shines through and the distinction between purusha and buddhi becomes clear. Apavarga means a state in which the empowerment of gunas can be abandoned and transmigration into cycles of birth and rebirth etc can be terminated. Hence the word apavarga has been used for ‘liberation’. Both bhoga (experience) and apavarga (liberation) are happening in the buddhi (intellect) since Purusha, in the true sense, is simply a witness. As mentioned above, they are attributed to Purusha only because the buddhi functions based on reflected consciousness from the Purusha. Apavarga implies that all identification between the Purusha and what is happening in the buddhi is severed and Purusha remains as a pure witness.

2.19 -- visheshavisheshalinggamatralinggani gunnaparvani

The gunas generate their characteristic divisions and energies in the seer. Their stages are distinguishable and non-distinguishable, differentiable and non-differentiable.

This sutra analyses nature (prakrti) by distinguishing the progressive layers of its manifestation, from the most specific and definable, up through the non-specific and non-distinguished and back to the undifferentiated or universal. The individual counterpart of cosmic intelligence (mahat) is consciousness, or citta. Citta consists of mind (manas), which reviews sensory and vibrational stimuli, intelligence (buddhi), which is the discriminative faculty and ego or small self (ahamkara) which is the individual 'I'. In addition, hidden deep within man's nature is a powerful hidden spiritual weapon - 'conscience' (antahkarana or dharmendriya) which personifies ethical and moral principles. Antahkarana observes right and wrong in one's conduct and motives, helps to cultivate citta and directs it to perform only the righteous actions. There are also the five senses of perception - ears, tongue, eyes, nose and skin, and five organs of action - legs, arms, speech, genital and excretory organs. These are the principles of prakrti. The five elements, intelligence, senses of perception and organs of action are distinguishable, i.e., physically manifest in concrete form. The other parts, the five subtle manifestations of the elements and the 'I' consciousness (ahamkara, antahkarandand asmita) exist in a non-distinguishable or vibrational form, being non-primary and un-evolved matter. Yet, all these revolve around the three gunas of nature - tamas, rajas and sattva. The principles (tativas) of distinguishable elements (visesa) give rise to changes which may be pleasant, unpleasant or dazed (a state of suspended or deadened sensibility). The unspecified principles (avisesa tattvas) are un-evolved matter, and when such matter is transformed into a specified state, creation takes place. This is called pravrttimarga. The reverse process, mvnti marga, is the unifying of the specified in the unspecified, of the non-specified in and of nature into the universal spirit (purusa). The fusing of nature into spirit is a heavenly marriage, which becomes possible through the work of yoga.  Human mind is a part of that cosmic intelligence. Tanmatras, cannot be sensed by ordinary men. If you practice Yoga, however, says Patanjali, after a while your perception will become so fine that you will actually see the Tanmatras.  Tanmatra means – rudimentary or subtle element, merely that, mere essence, potential or only a trifle. There are five sense perceptions – hearing, touch, sight, taste and smell, and there are the five tanmatras corresponding to the five sense perceptions and five sense-organs. The tanmatras combine and re-combine in different ways to produce the gross elements – earth, water, fire, air and ether, which make up the gross universe perceived by the senses. The senses play their part by coming into contact with the objects, and carry impressions of them to the manas which receives and arranges them into a precept. The five substantial elements of the physical world are – ether (Akasha), air (Vayu), fire (Agni or Taijasa), water (Ap) and earth (Prithvi) in the order of their development, these are the five Bhutas from whose unlimited combination everything results including the living bodies which are material forms living in space and time. According to the Vedic theory of creation, the tanmatras are the basis of all corporeal existences because from them evolve the Bhutas, the building blocks of the perceptible universe. The tanmatras, the subtle matter, vibratory, impingent, radiant, instinct with potential energy and collocations of original mass units with unequal distributions of original energy, evolve out of the Bhutadi which is only an intermediate state. They have some mass and the energy and physical characteristics like penetrability, powers of impact, radiant heat and viscous attraction etc., and have effect on the sense after assuming the form of paramanus or atoms of the Bhutas (the created ones) which process is Tattavantraparinama or primary evolution. In evolution the total energy always remains the same redistributed between causes and effects, the totality of effects exists in the totality of causes in the potential form. The collocations and regroupings of the three Gunas (attribute or property) induce more differentiated evolutes; they constitute the changes leading to evolutions i.e. from cause to effect, which process is based on Satkaryavada, the doctrine the effect is existent in the cause even before the causal process has started to produce the effect operating in accordance with the two laws of conservation of matter and energy. According to Satkaryavada  theory the effect is existent in the cause; the original cause of everything that is perceived is Prakriti. Satkaryavada is a hypothesis according to which the effect pre-exists in a potential state. The causal process involves a modification of a stable underlying reality. The effect is not produced as a reality that is distinct from its underlying cause. It is a specific rearrangement of that causal substrate. The Samkhya system is based on the principle of Satkaryavada. The effect pre-exists in the cause here. Cause and effect are seen as temporal aspects of the same thing. It is considered as theory of existent causes. The effect lies latent in the cause which in turn seeds the next effect. It maintains that effect is real. Before its manifestation it is present cause in a potential form. According to Satkaryavada principle the cause is hidden inside the effect. This effect exists due to several reasons- 1.what is nonexistent cannot be produced; 2.for producing a specific material cause is resorted to; 3.everything cannot be produced; 4.a specific material cause is capable of producing a specific product alone that effect; 5.there is a particular cause for a particular effect. Adi Sankaracharya found Satkaryavada as a useful tool against the doctrine of Annica or momentariness. Two branches of Satkaryavada are vivartavada and parinamavada. The four stages of the gunas mentioned in this sutra correspond to the four stages of samadhi mentioned in sutra 1.17. Thus:Vishesha – Vitarka (Manomaya kosha) Avishesha – Vichara (Vijnananamaya Kosha) Linga – Ananda (Anandamaya Kosha) Alinga – Asmita (Atma/soul).  The visheshas (diversified) are the sixteen mutations – five bhutas (earth, water, fire, air and space)---five organs of action (arms, legs, tongue, organs of excretion, organs of reproduction)---five organs of sense perception (eyes, ears, skin, tongue, nose)---mind . Attributes like blue, red, sweet, sour etc are vishesha (diversified). The vishesha can be pleasant, unpleasant and stuporous. The avishesha (undiversified) are six in number:--the five tanmatras (sense of smell, taste, touch, sight, hearing) asmita (ego) which is the cause of the organs and tanmatras. Mahat (buddhi or intellect) is called ‘linga-matra’ (indicator only) which means that it is an indicator for Purusha and Prakriti. Prakriti, in the unmanifest state, is ‘alinga’, which is not the indicator of anything.

Bhoomiraapo’nalo vaayuh kham mano buddhireva cha;
Ahamkaara iteeyam me bhinnaa prakritirashtadhaa.-- Bhagavad Gita (7:4) 4000 BC

“Earth, water, fire, air, ether, mind, reason and egoism – these constitute the eightfold division of My Nature”

Ordinary water, earth etc do not constitute the bhutas (elements). That whose feature is sound is Akasha (space). Similarly touch goes with Vayu (air), sight with Tejas (fire), taste with Apa (water), and smell with Kshiti (earth). Akasha is the cause of Vayu, Vayu is the cause of Tejas, Tejas is the cause of Apa, and water is the cause of Kshiti. Because of this cause and effect, an object of the sense of smell is the receptacle of all five properties. An object of the sense of taste that of four (except smell), sight that of three, touch that of two and hearing that of one property only.Perception of smell comes from contact with particles of matter (earth/kshiti). Taste arises from chemical action caused by a liquid substance (water/aap). From heat (fire/agni) comes perception of color (sight/vision). Feeling of touch results from contact with gaseous matter (air/vayu). With the sense of sound arises a sense of emptiness or void (space/akasha). The five bhutas (gross elements) like earth, fire etc are the Visheshas of the five tanmatras. Visheshas represent three characteristics:To indicate the diversities of the notes of the scales of sound; heat, cold, hardness etc (touch), blue, yellow etc (fire/light), sweet, sour etc (taste), pleasant, pungent etc (smell). These diversities result in states of happiness, misery or indifference. These bhutas are the lowest form of mutation and are not the cause of any further modifications. The word ‘tanmatra’ means ‘that alone’ – sound alone, touch alone etc. That is, subtle sound, without any variation or diversity is the sound tanmatra. Same is the case with other tanmatras. When meditated upon, the subtle perception of each tanmatra appears only as a flow of time. All the tanmatras have emanated from Asmita (ego). Asmita (ego) is the pretentious feeling relating to self. Asmita also refers to the pure I-sense, buddhi, which is the subtlest form of egoism. Combination of one’s ego with the organs of perception creates I-sense which is called Abhimana.Organs represent different modifications of asmita. Knowledge of light, for example, implies the sense of identification of the Knower with the sensation of light. This feeling "I am the knower of light" is the ego called Asmita. Mahat or buddhi is the awareness that "I exist" or pure "I-sense". Modifications like "I am the hearer" etc is the modification of "I" and is termed ego or Ahamkara. Mahat tattwa (element) is the cause for Ahamkara. The Mahat principle gives rise to the six Avisheshas – Asmita (ahamkara) followed by the five tanmatras.At the time of dissolution, all elements disappear in the reverse order of creation. Finally, Mahat disappears into the unmanifest (Avyakta) prakriti. All manifested objects like Mahat etc are created to serve the two-fold purpose of Purusha (sutra 2.18). Unmanifest Prakriti, however, is eternally present, and is not created because it has no purpose to serve for the Purusha. Objects like Mahat are beginning-less; however, they are not without an end – they end when the purpose of Purusha (attaining the state of Kailvalya) has been served. All objects are the product of the three Gunas (sattva, rajas and tamas). Gunas are always present in Prakriti. The unmanifest state is one of equilibrium of the three gunas. At the time of dissolution, when the objects merge back into Prakriti, there is no dissolution for the gunas; they just merge back into Prakriti. The category ‘vishesha’ refers to the final evolutes that do not produce further products or evolutes. The category ‘avishesha’ refers to those evolutes that produce the final ‘vishesha’ evolutes. So, the five elements – earth, water, fire, air and ether are the vishesha evolutes of the avishesha – sound, touch, taste, sight and smell. Avishesha also includes ‘ahankara’ (ego) which is responsible for these evolutes – five organs of action (speech, hands, feet, anus, and genitals), five organs of perception (ears, eyes, skin, tongue, and nose) and the mind. The ‘linga-matra’, literally mark or a sign only, category refers to ‘mahat’ or ‘buddhi’ (the cosmic intellect) which is a mark or a sign for prakriti. Buddhi is like the root of a tree. It is the closest to the seed that produced it  and is also the cause of trunk, leaves, branches etc. Buddhi is also a transformation of the gunas. It represents pure ‘beingness’. Vyasa says that it is neither existence nor non-existence, neither real nor unreal. The final category, the subtlest of all, is prakriti itself which has been called ‘alinga’ (not a mark or symbol for anything). There is no sign to discern prakriti until there is disturbance in the balance of the gunas which results in the first evolute ‘mahat’. Prakriti is eternal whereas all its evolutes are temporary manifestations of prakriti. Everything that one experiences in manifest reality, including the subtlest level of viveka (discrimination) is taking place in the buddhi. In the alinga state, the gunas are balanced and cannot fulfill the objectives of Purusha – namely, experience and liberation (sutra 2.18). In that sense they may seem "non-existent". However, the gunas are capable of producing effects (evolutes) and hence can be termed "existent". Comparing these Samkhya concepts with those of the Vedanta school, we notice that in Vedanta, prakriti, the gunas and the entire manifest world are all mental constructs and mere superimpositions of templates on the only real existent, Brahman. On the other hand, as per Samkhya and Yoga, prakriti is existent, real and eternal.

2.20 -- drashta drishimatrah shuddhopi pratyayanupashyah

The seer is pure consciousness. He witnesses nature without being reliant on it. 

The seer ( unlike a schizophrenic ) has a clear boundary between the real physical world and the invisible world.. This sutra moves on from nature to soul, the Supreme Seer, the absolute knower. It is the pure essence of consciousness beyond words. Though the soul is pure, it is liable to see through its agent, the intelligence (buddhi) and being carried away by the manipulation of nature, it loses its identity. The previous sutra dealt with nature (prakrti) and discernible objects. Here, the nature of the seer, the soul (purusa) is described. Atma, drasta and drsimatrah are terms which illustrates the innate nature of the seer. Intelligence obscures consciousness in such a way that it comes to identify itself as the true seer and forgets the soul. But if intelligence can keep its power of discernment, consciousness too will remain uncoloured. If consciousness is clear, the seer is un-obscured. Intelligence, belonging as it does to manifest nature, is constantly in the process of change, sometimes conscious and often unconscious. It is subject to sattva, rajas and tamas, while the seer, purusa, is beyond all these, immutable and ever-conscious. When you use psychic power you tap into the level of the universe, where individuality does not exist. At this level each of us is a part of a universal and cosmic consciousness where we are connected as though held together by invisible threads. By learning to project your will and change your vibration through altering the state of your consciousness , you will begin to develop psychic powers. The expanded abilities of self awareness is abstract reasoning, free will, creativity, foresight etc.   Our culture is oriented towards reducing one’s self awareness rather than expanding it. Most people never raise their consciousness much above that of the beast and the spark of divinity within them remains dormant the whole of their lives . Perception occurs in the gap of alert attention. This is the inner space. When you visit new places , the experiencing and sense perception takes up more of their consciousness than thinking . You can create a gap in the mind stream simply by directing the focus of your attention into the NOW.  Consciousness enables us to think and at the same time observe our thinking process. The brain without consciousness is inert and lifeless.  Consciousness is a form of matter just as matter is a form of consciousness. All atoms in the entire universe are capable of mind reading and communicating with other atoms. Our consciousness is a cosmic DVD player. India there is the ancient tradition of the enlightened sage, the one who breaks free of ordinary human conditioning and attains a state called "awakening By various means such as deep meditation or by pure devotion, or by the control and understanding of the mind these historical figures broke through into universal consciousness itself, and beyond that even, into the pure awareness of the absolute. They experienced a quantum leap and a arrived a state that cannot be defined and described. People simply called them the enlightened ones. Cosmic Consciousness lies in a mystic state above and beyond Self-consciousness, which is an acute sense of self-awareness.

 2.21 -- tadarth eva drishyasyatma

The very existence of the seen is for the sake of the seer.

Nature and intelligence exist solely to serve the seer's true purpose - emancipation.  Intelligence exists to serve as the seer's agent, to liberate the consciousness from avidya. If the sadhaka slackens in his sadhana and becomes inattentive, the senses agitate the seer and he is again hitched within the pleasures of the senses. This study of mind and investigation through intelligence is the innermost pursuit - antaratma sadhana. This sutra conveys that consciousness, the essence of nature, which is cognisable, exists for the sake of the seer who sees for the sake of seeing.  As a dancer,  after having performed for the observer , stops dancing, so does Prakṛti cease to perform for an individual Puruṣha when her task is accomplished—a corner stone of Samkhya Vedanta . The dancing girl dances as long as the male observer is there. The moment the observer ceases to look at her and understands the dance perfectly, she fails to amuse him anymore. Purusha, or supreme consciousness ( BrahmAn ) , is the impassive observer of all phenomena. She moves from transcendence to immanence and undergoes a series of transformations through which the multiform world comes into being.  Purusha, was never really in bondage, or enmeshed with Prakriti.  Prakriti cannot be perceived, not because of its non-existence, but because of its subtlety. It is perceived in its effects. Sankhya  accepts the principle of satkarya-vada, i.e. the effect exists in cause. 

The ignorant differentiate between Sankhya and Yoga; not the wise. He who considers the two as integrated has the right insight – Bhagawat Gita (5.4) 4000 BC

I have said before that two paths are available in this world - Yoga of knowledge as followed by the Samkhyas and Yoga of action as practiced by the Yogins .– Bhagawat Gita (3.3)- 4000 BC

The root cause (Brahman) is to be apprehended by Samkhya-yoga - Svetasvatara Upanisad (6.13) -5000 BC

There is no wisdom like Samkhya – Mahabharata 4000 BC

In Samnkhya, direct perception is the most important and fundamental source of all knowledge. When senses cannot directly perceive due to their limitations, inference is needed such as in philosophical disputations. The very existence of Purusa ( BrahmAn – morphogenetic consciousness ) is possible only through inference. Patanjali drew heavily upon Sankhya philosophy in the development of his Yoga Sutras, and many of the practical methods and techniques of yoga rest on Sankhya's philosophical foundations. . Yoga is  a complete exercise program for body,  mind and spirit. SaMkhya and SaNkhya is same .  Samkhya as you can see was a masterpiece of modeling the ways of the inner universe. Maharishi Kapila said that the universe arose through the union of nature (prakriti) and consciousness (purusha).

Of all trees I am the banyan tree, and of the sages among the demigods I am Narada. Of the Gandharvas I am Citraratha, and among perfected beings I am the sage Kapila.- Bhagawat Gita (10.26)

Sankhya unified the two concepts of science and religion by demonstrating its equivalence through axiomatic laws. The Sankhya system is based on Sat-kārya-vāda or the theory of causation. According to Satkāryavāda, the effect is pre-existent in the cause. Philosophical texts from this era such as the Katha Upanishad, Shvetashvatara Upanishad and Bhagavad Gita have clear references to Sankhyan terminology and concepts. The Sankhya system is an evolutionary theory of matter beginning with primordial matter. In evolution, Prakriti is transformed and differentiated into multiplicity of objects. Evolution is followed by dissolution. In dissolution the physical existence, all the worldly objects mingle back into Prakriti, which now remains as the undifferentiated, primordial substance.  Tantric system borrows the abstract dualism of Sankhya and modifies it into a personified male–female dualism. The white invader converted Tantra into debauched sex. As we evolve, the spirit will control the mind and body to determine our thoughts, words and actions. At the apex of evolution, the mind takes its cues from the spirit and the body from the mind.

2.22— kritarthan prati nashtam apyanashtan tadanyasadharannatvat

The relationship with nature ceases for emancipated beings, its purpose having been satiated, but its processes continue to affect others

As soon as the vehicles of nature which act as agents of the seer fulfill their task of freeing him from his mental and sensory prison, they are stilled, having reached their purpose. The bond between the seer and nature comes to a culmination. Nature ceases to exist for him. He is able to perceive his own form (svarupa). However, the vehicles of nature, elements, their subtle qualities, cosmic intelligence, individual self, ego, intelligence, senses of perception and organs of action are common to all, so for others, who remain caught up in the world's commotions, the bondage lives on. In the thirteenth chapter of the Bhagavad Gita, the one who sees the field (prakriti) as distinct from the knower of the field (purusha) is called wise. Krishna advises Arjuna that "He who sees himself not to be the doer, he sees indeed (Bhagawad Gita  XIII:29). When the seer is perceived as distinct from the "I" that claims, the yogin then loses interest in the generation of compulsive citta-vrittis (mind chatter ).. Nothing is claimed by the "I". With this movement the sediment of prior conditioning (samskara) is cleared away; objects shine forth devoid of inherent, defined form (svarupa-sunya); the consciousness-of or "I-vs.-that" consciousness has retreated; pure witnessing takes place. In this state of pure consciousness, attention cannot be separated from the intended: awareness is both subject-free (anahamvadi) and object-free (nirvastuka). Yoga may thus be defined not as a union of appropriating self with objects, even religious objects of appropriation, nor as Cartesian separation of thinker from thought, but rather as a moment in which there is the nonseparation of knower, knowing, and known. The point of yoga is to have direct access to the intended world without the interference of impure residues. Yoga seeks to sever projects, present from a time without beginning, that obscure direct perception through the seer. the yogi excises a part of his corpus of being--citta vritti--so that the unseen seer, the witness, may be known. 'Mind' is not a proper English translation of what the Yoga calls 'Chitta', especially in the system of Patanjali. The entire mind-stuff is called Chitta. It is better to use the word 'psyche' instead of the word 'mind', because the former denotes a larger composite structure than the single function indicated by the word 'mind'. Mind is that which thinks in an indeterminate manner; the intellect is that which thinks in a determinate manner; the ego is that which asserts the individuality of one's own self. There are other functions of the psyche such as memory, often associated with the subconscious level. It is impossible for anyone to be aware that something is outside, unless there is an isolated thinking or an individualising principle, known in the Vedanta psychology as the Antahkarana, and in the Yoga psychology of Patanjali as Chitta. "Antahkarana" is a Sanskrit term, which literally translated into English, would mean, "the internal organ". That is perhaps the best way we can put it in English. The internal organ, by which we cognise or perceive things outside, is the Antahkarana. The same thing is called Chitta in Yoga psychology. Yoga is control of the mind, restraint of the mind-stuff. Yoga is Chitta-vritti-nirodhah. As a word, vritti means literally vortex (of consciousness), or "circular activity with no beginning and no end". Training in yoga in the larger sense – namely, concentration, attention, and meditation – can help stop these fluctuations and quiet the chatter, so that you can get in touch with a truer sense of self, and a more peaceful, watchful sort of awareness. In the context of Hinduism and yoga, vrittis refer to different tendencies, or psycho-physical propensities, which give scope for the mind to express a variety of feelings and emotions. Hindu texts describe samskaras to be a result of past actions and experiences that have left an imprint on the mind. The expression of samskaras gives rise to vrittis, which collectively represent the behaviour that makes each person unique: their desires and repulsions, their predispositions and complexes. Purusha is the Witness. Prakriti produces effects for his enjoyment. Purusha is ‘solitary, neutral, a spectator, and non-agent’ (Samkhya Karika). Purusha is solitary because even though as consciousness he is the Witness to the effects produced by Prakriti and her three gunas, Purusha remains pure and untouched. The three gunas are born of Prakriti. It is their imbalance that causes the wheels-within-wheels to turn and produce the hologram. After a cyclical Dissolution of the world the gunas return to and remain in a state of perfect balance until next time of Creation. Purusha abides in Prakriti (prakritsthas) as Witness to the effects of her gunas (Bhagawad Gita .XIII.21). Even though Purusha as Witness remains untouched by the gyrations and effects of Prakriti’s gunas, Purusha temporarily mistakes these ‘transformations’ as his own. Purusha wrongly assumes that he is the ‘agent’ of Prakriti’s manifestations. The Samkhya Karika states that it is his proximity with Prakriti that causes this false impression. In the process of his enjoyment of the world, Purusha begins to consider the polarities of pleasure-and-pain (sukha-duhkha), etc. as his own. This confusion, caused by attachment, eventually makes Purusha realize that he has become bound in the webs of Maya that are produced by Prakriti's gunas. Therefore after experiencing pain, Purusha realizes that he has become attached (guna-sangas) to those polarities which are the cause of the endless cycles of birth and death in both good and evil wombs (sad-asad-yoni-janmasu). The Atman enters into human bodies and becomes Purusha, which is Consciousness. There Purusha ‘correlates’ with the Unmanifest principle Prakriti, which is not conscious but has the female power (Shakti) to produce and manifest this polarity universe through the three gunas. The proximity - a sort of illusory union - of Purusha to Prakriti causes Purusha to forget his real state, which in reality is not capable of being affected by Prakriti’s changes; and he begins to mistake these effects, pleasure-and-pain (sukha-duhkha), as his own. Krishna tells Arjuna that the one who Knows from direct experience (vetti) this temporal and actually nonexistent ‘correlation’ between Purusha the real Self as Atman and the unreal Prakriti who produces the illusory, is not born again! Knowledge of the Real brings release from endless transmigration ( Bhagawad Gita XIII.23). Purusha is the Witness and experiencer. Prakriti works through the three gunas and the five senses to produce what Purusha experiences. Purusha would not develop this Discriminative Wisdom without Prakriti providing the experiences of pleasure (sukha) and pain (duhkha), etc.Purusha becomes indifferent ...The game is over once Purusha realizes the mechanics of their ‘correlation’ through his newly acquired Discriminative Wisdom. He recognizes that she is distinct from him. He comes to know her. The text says literally that she is ‘seen’ by him (maya drsta) and therefore he becomes indifferent (iti upeksha-kah). The one (Purusha) thinks: ‘she has been seen by me’ and therefore loses all interest; the other (Prakriti) thinks ‘I have been seen’ and ceases to act further. Therefore, even if there is still connection there is no motive for further evolution.--- Samkhya Karika, Verse 66. The writer of the Samkhya Karika compares Prakriti to a maiden who is modest in the sense of being extremely delicate with an acute sensitivity and ‘who cannot bear exposure to the prying glance of a stranger ... Having been seen [recognized] once by the Purusha through discrimination, will in no case expose herself again.’ My opinion is that nothing is more modest than the Prakriti: Knowing  that ‘I have been seen,’ she no more comes within the sight of Purusha.---- Samkhya Karika, Verse 61.While this comparison obviously is taken from another time when women of noble descent were not permitted to be seen by strangers or even the sun, the meaning is conveyed that for Prakriti the performance is over and she will not continue her dance. The gunas will cease their allure and stop the show.Destroyed like a burnt up seed ... We are told that perfect Knowledge is attained by this ‘recognition’ and afterwards Purusha ‘continues to live for a while invested with the body, just like a potter’s wheel continuing to revolve, even when the potter ceases in his efforts at revolving the wheel due to the momentum of the past impulse’ (Samkhya Karika 67).,,The attainment of ‘direct knowledge’ causes the ‘entire stock of subliminal impressions of deeds,’ which are the fuel of repeated births, to get ‘destroyed like a burnt up seed, and no more produces any fruit in the form of experiences of rebirth, life, etc.’‘ ... is not born again’.

2.23— svasvamishaktyoh svaroopopalabdhihetuh sanyogah

The conjunction of the seer with the seen is for the seer to discover his own nature.

The powers of purusa and prakrti are designated for Self-Realisation. The purpose of their contact is the blossoming of their innate powers, and the seer's discovery of his own essential nature.  This sutra makes clear that a desire for synthesis or a close association or assimilation between the owner, the 'owning' and the owned has existed since the beginning of civilization. By the light of pure knowledge, the owner, the seer, perceives and cognises whatever is to be perceived or cognised through his association with nature. If this association is fed by ignorance, it leads the master towards enjoyment, desire, and complaints, and ties him down. But if non-attachment is garnered, it leads to detachment or renunciation - vairagya. If the master maintains constant vigilant awareness of his consciousness, associates with nature without attachment and stays a witness, nature (prakrti) leads its owner, the soul, to freedom – moksa. The cause of our painor pleasure is always our joining ourselves with the body.Samyoga is connection or an intimate union between the mind and the being or Purusha, which allows the Purusha to observe the outside world. It is another story that although the experience is happening outside of the Purusha, this very union causes the Purusha to associate and attach with the experience and get dragged around by it.   Rather than simply observing, when the Purusha gets attached to the experience due to the samyoga, that is the root cause of suffering. The union of Owner (Purusha) and owned (Prakiti) causes the recognition of the nature and powers of them both. Union is necessary for the Purusha to realize himself with the help of Prakriti. When apart, they don’t express themselves. Through the Prakriti we realize that we are the Purusha. Perceiving the worldly objects is experience and perception of the real nature of the seer is liberation. Ignorance is the cause of the union between the seer and the seen whereas true knowledge dispels ignorance.  True knowledge is not the real cause of liberation, but technically it is the absence of ignorance that results in liberation. Full liberation is a step beyond discriminative intelligence and involves complete separation between purusha and buddhi. Prakriti, or buddhi, shows ignorance as it needs purusha for its functioning.   Purusha, too appears to have ‘adarshana’ as it needs to provide illumination to the buddhi. In sutra 2.17 Patanjali states that "union between purusha and prakriti is the cause of the suffering that can and should be avoided".  Now in sutra 2.23 we note that "this union between purusha and prakriti is REQUIRED to understand the true nature of the powers of both purusha and prakriti".  So, it seems as if this union is both good and bad depending upon how we look at it. My understanding is that it causes suffering when we are only interested in the ‘experience’ of the material world. On the other hand this union can lead to kaivalya if start working on developing discriminatory wisdom and finally realize the separation between purusha and prakriti. I wrote the below in my blogsite profile. QUOTE:- This blogsite will transform your mind . You yourself, are the teacher, the pupil, the messiah, the seeker, the traveller and the destination . It is no measure of health to be well adjusted to this profoundly sick society :UNQUOTE  .   COMMIES ( atheists ) without core values  killed maximum people on this planet.  Why? We have been brainwashed from a young age by big brother’s media.  150 years ago, Darwin had zilch idea , what DNA is,  or a cell is.  He was under instructions by Freemasons to say exactly what he said—to remove God and intelligent design from the equation and to shove in EVOLUTION . As per this nonsense, Giraffes neck became longer as the poor animal was given taller and taller trees to eat leaves from— really?  Oh yeah ??   7000 years ago Sanatana Dharma knew this is nonsense. A cell is the smallest unit of the human body and hence is the building block of life. There are millions of different types of cells, which have unique functions and features. The total amount of cells in a human body exceeds 100 trillion—or one hundred thousand billion cells. You cannot imagine how complex a microscopic cell is unless you enlarge it mentally say to the size of a huge bubble say the size of Mumbai. Only then you will appreciate the mind boggling and supreme intelligent design, with the surface of the cell having millions of ports, constantly opening and closing –allowing constant passage in and out.. Our ancient seers understood the majestic human body . More than 500 processes take place just in one cell of the liver, all in terrific speed of nano seconds. About 1 billion red blood cells are produced in the body every hour, inside each of which there are about 300 million molecules of Haemoglobin..  Every cell in our body came from division of the original single sperm cell. After that every cell chose its own individual shape and its tasks in a CONSCIOUS  manner, to make you look like what you see in the mirror externally. Atheists and commies why deny god do NOT understand all this. Every new cell knew where it must go and what it must do, when to start dividing, when to top dividing, with whom to form partnership, whom to keep away from, which hostile bacteria to kill, which friendly bacteria to ignore, when to commit suicide , what human organ it must form—all with perfect timing. They are all aware of each others functions and there is total harmony. Why are our NCERT books still peddling mad man and Rothschild agent Charles Darwin’s theory ? What is the Indian govt afraid of ? Or is Jew Rothschild still ruling India ?   Does our govt still think that the mangy sack of Darwin containing ridiculous goodies like dried finches and beaks  he picked up from Galapagos islands and Patagonia had all the answers?  Nobody else on the planet understood consciousness the way the ancient maharishis undertood it.  They were NOT dreamers , but supermen . Modern doctors know that if you give an unconscious person a placebo injection, it wont work. Consciousness plays a vital role. What is consciousness? A double slit quantum experiment revealed to the shocked world the powers of observation and consciousness in COLLAPSING A WAVE into matter— or the power of mind over matter.  After the shocking double slit experiment almost all western physicists converted to Hinduism and wrote down in their wills that they want to be cremated.  6200 year ago Ayurveda depended  on the mind body connection to heal the body. It is about “remembered wellness” —to bring the body back to its original energy DNA blueprint state. This is different from western medicine which works on a “ cause and effect “ principle, and addressing the symptoms till they disappear.  This causes side effects. Matter and mind are both possibilities of consciousness. Collapsed quantum possibilities could be physical or mental. It is about conscious choice and downward causation. This downward causation is free and unpredictable and the result of CONSCIOUS CHOICE, where outer follows inner-- it does not care for logical algorithms. Quantum healing works outside the fabric of space and time.True natural healing takes place at the quantum level.The holographic brains extension throughout the body is the nervous system.  The pineal gland has a lot to do with the placebo effect, as it has to do with the energy body. The only reality is consciousness. It is our intent that affects reality. Mind can wipe off mistakes or deviations of the blueprint .  DNA protein scientists may not agree, that in natures perfect design nothing ever dies. Brain is the ultimate pharmacy.  It produces the ultimate body friendly  antibiotics, painkillers, tranquilisers etc with perfect dosage. This is the  reason why there are no side effects. Consciousness affecting reality is the placebo effect. Mind is non material but it works in partnership with communicator molecules.  A quantum event does not follow cause and effect rules. How did the ancient Indian yogis survive on substandard diets for several years during severe penance?  Alexander the great came to India as he knew that all ancient Greek knowledge (100% )was from India, stolen and patented . His own religion was pagan Indian. Alexander the Great’s soldiers witnessed sages in deep meditation hopelessly entangled in creepers with cobras crawling due to the vibes -- and got totally psyched. They could not understand all this, it created fear , and they were done . They wanted out !

2.24— tasya heturavidya

Lack of spiritual understanding (avidya ) is the cause of the false identification of the seer with the seen.

Avidya and maya are the same, but avidya is individual and maya is cosmic.   Maya is only an instrument that Brahman uses to project the universe.  Through maya Brahman projects Himself as many.  Amalgamating of prakrti with purusa can either lead to emancipation or block one's progress by enmeshing one within desires and emotions.  Avidya, ignorance or lack of awareness, is at the root of the confusion that fetches suffering to one as well as pleasure. Vidya (discriminative knowledge) destructs ignorance, because a fire will burn only as long as fuel lasts.  When discernment relegates doubt, pure understanding begins the process of disownment and detachment which releases one from the pinions of possessing and being possessed. Avidya is the first of the 5 kleshas (which means coloring or veil), it is the first veil that covers the non-dual formless Consciousness.  The 5 kleshas are avidya, asmita, raga, dvesha, abhinivesha.  Avidya appears in four stages: 1) dormant or inactive, 2) attenuated or weakened, 3) interrupted or separated from temporarily, or 4) active and producing thoughts or actions to varying degrees. Avidya means without Truth or without knowledge. It is the first form of forgetting the spiritual Reality. It is not just a thought pattern in the conventional sense of a thought pattern. Rather, it is the very ground of losing touch with the Reality of being the ocean of Oneness, of pure Consciousness. Avidya is usually translated as ignorance, which is a good word, so long as we keep in mind the subtlety of the meaning. Ignorance is something that is removed, like removing a veil that obstruct the view. Then, with the ignorance removed, we see knowledge or Vidya clearly. Prakriti is known as Maya; when impure (being mixed up with rajas and tamas) it is called Avidya.  Once the basic principles of Avidya (Veiling, Ignorance) are understood, as well has how they progressively move awareness outward through Adhyasa (Projecting, Superimposition), it is easier to see the way in which these two are systematically reversed so as to attain the highest goals of traditional Yoga. Avidya (Nescience) or Maya, is also the Undifferentiated. There is no Ignorance (Avidya) outside the mind. The mind alone is Avidya, the cause of the bondage of transmigration. When that is destroyed, all else is destroyed, and when it is manifested, everything else is manifested.   With the rise of Vidya or realization, the entire effects of Avidya, even though beginningless, are destroyed together with their root – like dreams on waking up from sleep. The knowledge of the identity of the Jiva and Brahman entirely consumes the impenetrable forest of Avidya or Nescience. For one who has realized the state of Oneness, there is no seed left for future transmigration—seeds are fried. The Gurus as well as the Shrutis instruct the disciple, standing aloof; while the man of realization crosses (Avidya) through Illumination alone, backed by the grace of God. Nescience or Avidya has two functions: Avarana or the power to conceal and Viksepa or the power to project. You don’t see the universe as it really is because your perception of the universe is individual. You see things only partial through a little window of your eyes. This partial knowledge ( narrow window bandwidth / squelched senses ) has nothing to do with the totality of experience ( six blind men and the elephant ) and thus cannot be considered to be truth. The knot of ignorance and the knot of karma ( past soul samskaras /impressions ) compose the nature of avidya. Jiva is endowed with all the same qualities as Brahman, but jiva, through its association with avidya, thinks itself to be limited.  . When the jiva, the individual soul, learns to be free from the strong clutches of avidya, he realizes his true Self and becomes one with Brahman. You can remain in the bondage of avidya or you can release yourself. It is your choice. You are the way you are because you wanted to be this way. No one else has described for you or made any plans for you. This is your own planning. Each individual creates avidya. Thus it is your own ignorance and superimpositions that are responsible for your suffering. Without eliminating attachment and passions, spiritual knowledge does not arise. The joys of the sensory gratification that one delights in are short-lived, and when the fruits of these actions are exhausted, one again falls back into the cruel clutches of avidya or ignorance. The term maya is closely related to with avidya. Maya can be described as apparent reality—that which does not exist though it appears to exist. Ma means “no”, ya means “that”. An example of maya is a mirage in the desert. Even though you think you see it, it doesn’t exist. Maya can cause you to have an accident, but it cannot enlighten you. Maya is the reason you see the one absolute truth as many. The process of unlearning,   is about freedom from the conditioning or from the known. Unlearning things that are no longer useful can be an extreme form of changing, like an almost physical casting off of inner clothing.  Unlearning involves a conscious individual confrontation of the past with the future, involving paradigms or beliefs that come from the fully formed past at odds with those that come from a future, still in formation. If you need to fill up water in a bottle, the ( hot ) air which served the bottle well for long time, must be allowed to escape. Unlearning is about moving away from something rather than moving towards something. Unlearning is not about right or wrong. It is about being open to and exploring something that lies underneath the judgment, underneath the right and the wrong. The learning cycle, which should be a virtuous circle that positively feeds itself. Our habit of planning  in a particular way may have to worked wonderfully well in the past, but unknown to us, it has become a primary cause of our inability to adapt to changes in our context.  Even in mild  forms, these habits can become ingrained, comfort zones, addictions, hiding places of denial and self-protection. Often our ability to see something, to appreciate its true nature, is skewed or hidden by the judgement we give it, the pigeon-hole we have prepared for it. .Old ingrained habits that do not serve us take time to break and some may never be broken. Behind the fears live the memories that gave rise to them . The cat who fell in hot water is circumspect with cold water too. We cannot disprove our past or invalidate our memories. We go back and work gently with what happened, see the memories afresh and hopefully find the strength necessary to free ourselves from their power with active help from yoga. It is painful to unlearn those deep, hidden and sometimes painful patterns that mask and influence the way we do things. Added to this are soul samskaras ( phobias )  picked up from past lives. Ultimately, we have to acknowledge that it is not our methods, strategies, tools or techniques which define the core and quality of our development practice, but ourselves  our past, our present and our future, and the will we can find to face these. In Sanskrit when an ‘A’ is placed in front of a word it means ‘not’ or ‘without’ that word. So ‘A’ in front of vidya means not vidya. Vidya is a word used for the highest Truth, Knowledge, or Knowing. When one truly experiences the non-dual formless Consciousness, one really knows, one lives in vidya, one lives in knowing the Absolute Reality. Therefore avidya is a state that means you are not living in vidya, the truth is forgotten, is veiled, and therefore is it a state of ignorance of ignoring truth. To remove everything that is not vidya will bring the experience of vidya. Therefore it is the avidya that we have to deal with, get to know and move beyond. We need to un-color this coloring in order to find vidya. To say that we live in ignorance doesn’t mean that we are dumb or stupid, it is merely a realization that we are ignoring our true Self (that we live unconsciously while our true nature is pure Consciousness) and that this avidya needs to be removed. Avidya is all bad, because if the veil would be lifted all at once we would not be able to take it. Even our fives senses have narrow bandwidths and are squelched to prevent overload and breakdown.  We dont need to see the waves going from the TV remote to the TV.   There is so much unconscious movement underneath the veil that it would flood us if it would be presented to us at once, probably make us literally crazy. Therefore this veil is like a mother, who lovingly hides what we cannot take until we are ready to take the responsibility. When our responsibility grows we will be able to allow the unconscious movements to come forward and not get sucked into them. We would be able to know that these movements are not who we are and will be able to stay non-attached to them. Therefore, it appears as if avidya and vairagya are dancing to together. In the beginning avidya has the lead, lovingly keeps us protected as a mother, but slowly with practice vairagya will take over this dance until the whole veil can be lifted and the Self rests it its own nature. avidya is used when we speak of individual ignorance, and the word maya is used when we speak of cosmic illusion. The word maya is used is regard to Brahman, when the Absolute Reality seems to play as maya.   Mind you, these explanations are NOT for the shallow minded.

IX: They enter into blind darkness who worship Avidya (ignorance and delusion); they fall, as it were, into greater darkness who worship Vidya (knowledge).

X :By Vidya one end is attained; by Avidya, another. Thus we have heard from the wise men who taught this.

XI: He who knows at the same time both Vidya and Avidya, crosses over death by Avidya and attains immortality through Vidya. Those who follow or “worship” the path of selfishness and pleasure (Avidya), without knowing anything higher, necessarily fall into darkness; but those who worship or cherish Vidya (knowledge) for mere intellectual pride and satisfaction, fall into greater darkness, because the opportunity which they misuse is greater.-  Isha Upanishad 5000 BC

Om Purnamadah Purnamidam
Purnat Purnamudachyate
Purnasya Purnamadaya
Purnameva Vashishyate
Om shanti, shanti, shanti—  Isha Upanishad 5000 BC

Om. That is infinite, this is infinite;
From That infinite this infinite comes.
From That infinite, this infinite removed or added;
Infinite remains infinite.
Om. Peace! Peace! Peace!

The path that avidya (or ignorance) leads one to and the path that vidya (or knowledge) takes one through are extremely different ones and are very far from each other. O Naciketas! I understand that you are the one in search of knowledge since you are not interested in fulfilling all the worldly, material desires that I offered to grant you. Those desires did not move you even an inch from your strong focus (of attaining the knowledge).  Katha Upanishad Chapter 2 Verse 4 -5000 BC

“When all things that have a beginning are ruled out, what remains is the truth – which is the cessation of avidya or ignorance. You may regard it as something or as no-thing: that is to be sought which is when ignorance has been dispelled. The sweetness one tastes is not experienced by another: listening to someone’s description of the cessation of avidya does not give you enlightenment. In short, avidya is the belief that there exists a reality which is not Brahman or cosmic consciousness. When there is the certain knowledge ‘This is indeed Brahman’, avidya ceases.” Yoga Vashista

2.25—tadabhavat sanyogabhavo hanan taddrisheh kaivalyam

The destruction of ignorance through right knowledge breaks the link binding the seer to the seen. This is kaivalya or emancipation.

By the removal of ignorance, conjunction is removed. This is the absolute freedom of the seer.This sutra explains the effect of breaking down the link that binds the knower to the known. At this point, the seen loses its hold and influence on the seer, miseries terminate and the soul is heightened to experience perfect freedom. Yoga is specifically designed to help one avert the sort of slips and errors in one's conduct which store up future sorrows, and it builds up one's strength, vitality and valour to deal with the inevitable problems of life. One is aware that one's mind turns more gladly to the world's pleasures than to the vision of the soul. It is a bridge between the senses and the spirit; it is a secret enemy, and a deceitful friend, which can change one's conduct without giving one time to consider. Patanjali advises the sadhaka to train the mind and encourage discrimination, so that objects and events are seen only for what they are, then they cannot gain power over one. This is exceedingly difficult, but an understanding of nature will help. Humans are matter (temporarily) and live surrounded by matter. Interaction with matter or nature is the condition of one's life. Without discrimination one cannot break free, but with understanding and practice one can use this interaction to reach highest peace and bliss. One should exercise discrimination and thereby realise that attachment to sense objects which give instant gratification is the cause of bondage and non-attachment to sense objects leads to liberation. So it is mandatory that infatuation with sense objects is renounced. One should not debase oneself clinging to the lower nature like the animals. Lord Krishna in Bhagawad Gita emphasises the changing nature of the mind. Attachment to worldly pleasures and hedonist values locks one to samsara or the endless cycle of birth and death while contrarily detachment from the infatuation of worldly pleasures frees one from samsara. 6000 years ago, in the middle of the battle field of Kurukshetra , Lord Krishna reveals the method of escaping perpetual incarceration in the material existence. The mind has the propensity to be one's dearest friend so why not utilise it to uplift oneself out of material darkness and into spiritual light. A controlled mind can accomplish so many beneficial endeavours for one's wellbeing. Whereas an uncontrolled mind is one's worst enemy performing base and degrading activities leading to destruction.When the mind is freed from attachments one becomes lucid and clear and the mind is like one's best benefactor. When the mind is disturbed by attachments it becomes distracted and distorted and the mind becomes one's worst malefactor.If one wants to experience heaven on earth, one has to grasp the qualities of nature, the gunas, i.e., the polarity of rajas and tamos, the eternal pulse of nature between movement and stillness, and the higher balancing state of sattva. Nature has degrees of subtlety. Sometimes it is more densely or unmistakably manifest than at others, and Patanjali analyses as follows. The four parts are - distinguishable (visesa), unspecified or universal (avisesa), phenomenal (lihga) and, beyond this, noumenal (alihga). The five energetic qualities of nature, the elements, are, with the senses of perception and organs of action, distinguishable; while the five counterparts of the elements, sound, touch, taste, sight and smell are without specific signs (alihga); so also is the ego (asmita). All these are subject to the gunas, which intermingle the behavioural patterns of an individual. If one understands the flow of these forces, one can reach balance, and from balance go on to true freedom. If not, one is swayed from one extreme to another, between pleasure and another pain. Yoga, says Patanjali, is the way to harmonise oneself at every level with the natural order of the universe, from the physical to the most subtle, to reach the total state of health which brings stability, to cultivate the mind with real understanding, and to reach out ultimately to undifferentiated infinity. The seer is an absolute knower - awareness personified. Though pure, it becomes entangled in the illusions of the mind, which are part of nature. Yet the vehicles of nature are all there to help the seer to experience serene, pristine, divine purity. Then, the elements of nature and their counterparts ebb and unite in the root of nature, mula-prakrti.Perfection is attained when the intellect becomes as pure as the Atman itself. When the soul realises that it is absolutely independent and it does not depend on anything else in this world, this highest knowledge, Kaivalya, Isolation or perfect independence comes inhe soul feels that it is ever free, unchanging, immortal, beginningless, endless, infinite, beyond time, space and causation, full of bliss, peace and knowledge. The Purusha is an embodiment of intelligence. He is ever pure and eternally free. He is always the silent witness of the play of Prakriti. Through intellect, the Purusha appears as if seeing, although really he never sees or does anything. The qualities of intellect are superimposed on the Purusha.  Just as the real colour of the flower appears on the transparent crystal, so also the qualities of Buddhi appear on the Purusha. Hence, the Purusha appears to be happy or miserable. The Purusha unites with the Buddhi and enjoys the different objects. This is the cause for human sufferings. Ignorance is the cause for this conjunction. This Prakriti and Purusha are united from time immemorial. If this union is separated, the Purusha recognises his original, divine glory. The original conjunction is the union of Purusha with the Buddhi. Through Buddhi, he is united with body. He mistakes this perishable body for the real Purusha. Through this body, he gets united with wife, children, relatives and friends. The whole Samsara has started now. Disconnect yourself from the Prakriti and become a Mukta Purusha. This is the essential teaching of Raja Yoga.Spiritual detachment is isolation from transient desires and discarding shackles binding our body and mind to the world. When we approach the Divine, we escape the gravitational pull of worldly desires, and leap into an infinite dimension, free from material cravings and illusion of self-love. He who would be serene and pure needs but one thing, detachment. With detachment comes freedom of the mind from the material world, but at the same time, attachment to the Divine becomes even more essential. This is not the FAKE Bhakti Yoga thingy where singers keep wandering around singing praises of god and doing nothing else. Laws of Karma rule, they is no moksha without making the karmic baggage zero.

2.26— vivekakhyatiraviplava hanopayah

The ceaseless flow of discriminative knowledge in thought, word and deed destroys ignorance, the source of pain.

One must continually separate truth from untruth.   The means to liberation is uninterrupted discriminative discernment.   The steady flow of deep, discriminating awareness unravels the avidya (illusion) and leads to the liberation of purusa. The root word viveka means discrimination, meaning this deeper, discriminating awareness (vivekakhyatih) is the kind of knowledge that is beyond the senses. This knowledge is also beyond our intellect, and even our highest perception. Once we lift the veil of maya, our knowledge becomes even clearer, and we experience kaivalya, or liberation. Un-fluctuating sound judgement with unremitting awareness is the essence of true knowledge, the only means to eliminate ignorance and free the seer from the seen. It should always be kept in the highest state of awareness and attentiveness, known as vivekakhyati, the crown of wisdom.  The seeds of false knowledge need to be burnt up through unremitting yogic practices to maintain an unbroken flow of discriminative intelligence. Viveka is uninterrupted discrimination.  Adi Shankaracharya defines Viveka as discrimination; wisdom or Buddhi made active. In this seventh chapter, Sri Krishna emphasizes the need to translate knowledge into a living reality by practising it, i.e., the knowledge acquired through the higher mind has to be realized. In Viveka Chudamani, Adi Shankaracharya  says that foolish is the man who does not strive after freedom from bondage—after obtaining, at last, a human birth.  “Therefore let the wise one strive after Freedom, giving up all longing for sensual self-indulgence; approaching the good, great Teacher (the Higher Self) with soul intent on the object of the teaching”. (Verse 8).  Viveka is the discrimination between the real and the unreal, the permanent and the non-permanent, Atman and Anatma.  In Kaivalyopanishad, Brahma tells Ashwalayana, who wanted to acquire knowledge of the ultimate truth, "By faith, devotion and meditation you can understand the ultimate truth."  You must first develop Viveka or discrimination between the real and the unreal and Vairagya (dispassion)  for the enjoyment of objects herein and hereafter/ Vairagya born of Viveka only will be of a lasting nature. Such a Vairagya only will be helpful to you in your spiritual practices.

2.27—  tasya saptadhaa prantabhoomih prajna

Through this unbroken flow of discriminative awareness, one gains perfect knowledge which is composed of seven spheres.

According to Patanjali, the seven states of conscious awareness are - emerging consciousness (vyutthana citta), restraining consciousness (nirodha cittta), sprouted or individualised consciousness (nirmana cittta), tranquil consciousness (prasanta citta), attentive consciousness (ekagrata citta), fissured or rent consciousness (chidra citta) and ripe or pure consciousness (paripakva or divya citta).  Samyama means  integration.  Dharana, dhyana (the seventh limb), and samadhi (the eighth limb) taken together compose samyama. By the practice of Samyama, the Yogi gets knowledge and powers. Patanjali says that samadhi appears when we are able to let go of our mental machinations, samskaras (past psychic imprints), klesha (afflictive emotions), karma (programming), vasana (habitual tendencies), and similar habitual impositions of conditioning and conditioned belief systems, which support the citta-vrtti (spinning or slant/tilt of the mindfield). Since samadhi is essentially nirvikalpa (beyond concepts), and since concepts are built upon words, then obviously the words have to be let go. Dhyana (meditation) brings forth the dawning of an extraordinary transpersonal (more rarefied than the most subtle) consciousness which can not be brought about without the complete stilling (nirodha) of the ordinary mind which is constantly being modified, colored, and disturbed (yogash citta-vrtti-nirodah). The profound and sacred trans-rational (nirvikalpa), trans-cognitive (asamprajnata) and all encompassing non-dual truth of Reality-As-It-Is is self revealing once the doors of perception are opined -- once the practitioner gets in touch with the intrinsic light of wisdom within and the veil is lifted. various applications of samyama can lead to the siddhis (accomplishments, abilities, masteries, and powers), but they are not to be seen as attainments because no ego attains or possess it.  The yogi’s true insight has seven ultimate stages. There are seven frontiers to be integrated between the seen (prakrti) and the seer (purusa). They comprise - integration of the body (safira samyama), the senses (indriya samyama), energy (prana samyama), mind (mano samyama), intellect (buddhi samyama), consciousness (citta samyama) and soul (atma samyama), each realising its own individual identity. Expertise in yoga will bring this sevenfold knowledge. 

2.28—  yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh

By dedicated practice of the various aspects of yoga, impurities are destroyed - the vision of wisdom radiates in glory.

Patanjali summarises the effects of yoga in this one sutra. He says that by habitual and dedicated practice, impurities of the sadhaka's body and mind are consumed, the causes of adversaries removed and the crown of wisdom is acquired. This wisdom and accomplishment keeps the sadhaka guiltless and free of conceit. Here, instead of the usual word abhyasa (repeated practice), anusthana is used. It is a venerable and noble word with a spiritual significance, implying practice with dedication or religious commitment. The former brings stability; the latter develops maturity of intelligence. Yoga can cure or diminish one's physical, mental, moral and spiritual woes. Perfection and success are certain only if one practises with love and whole-hearted dedication. Upon the destruction of impurities as a result of the practice of yoga, the lamp of knowledge arises. This culminates in discriminative discernment. By the practice of yoga, impurities are destroyed. These impurities,  are nothing but the five kleshas – avidya (ignorance), asmita (egoism), raga (likes), dvesha (dislikes), and abhinivesha (fear of death) – discussed earlier. When impurities are removed, the light of full knowledge (jnana-dipti) shines through. Starting with this sutra, Patanjali shifts the focus from the highly theoretical discussion to a practical approach for the attainment of the goals and objectives of yoga. Because of the wide acceptance of these eight limbs of yoga, Patanjali’s yoga is often referred to as "Ashtanga Yoga" or the "eight limbs of yoga".  In Sutra 2.26 Patanjali stated that the state of "viveka khyati" (discriminative wisdom) is the cause for the elimination of ignorance which leads to the apparent union between Purusha and Prakriti. In the current sutra, he lays out the means to get to that state of viveka khyati. Patanjali uses the term khyati  to mean  expound, so clearly that no ambiguity remains. khyati refers to the aspect of knowledge that clearly describes the defining characteristics of its object. By using this term,Patanjali is telling us that avidya-driven union comes to an end when our knowledge regarding the union of purusha and prakriti is crystal clear. Merely knowing that prakriti is the material cause of the universe and purusha is pure consciousness does not free us from misery. Such knowledge is purely intellectual, vague, and devoid of any practical substance. Khyati is totally different. It sheds such a powerful light on both purusha and prakriti that we realize instantly what we are. In the light of khyati, we know ourselves. We also know precisely what purusha and prakriti are, what caused them to embrace each other blindly and seemingly aimlessly, and what holds them together. At the dawn of this knowledge (khyati), we regain our faith and trust in ourselves. This gives us the strength to distinguish the real from the unreal, lasting happiness from short-lived pleasure, and true freedom from mere escape.This strength is called viveka shakti, the power of discrimination. This extraordinary knowledge (khyati), accompanied by the power of discrimination (viveka), here is termed viveka-khyati, the purest means of bringing this avidya-driven union to an end. Patanjali reminds us that this discerning knowledge (viveka-khyati) has to be strong and mature enough to withstand the test of time. We attain discerning knowledge with the help of meditation, self-examination, self-inquiry, and divine grace. After attaining this knowledge, we must make it firm with practice. We must not become careless. We must never forget how deceptive and powerful the veils of maya are; how undetectable her ways are of influencing our mind; and how important it is to safeguard and further nourish our newly discovered discerning knowledge.. Practice of these eight limbs of yoga serves as the cause in two categories – elimination of impurities and attainment of discriminative wisdom. Nine types of causes that are mentioned in the scriptures are:--Utpatti: production, Sthiti: maintenance, Abhivyakti: manifestation, expression, Vikāra: transmutation, modification, Pratyaya: cognition, Āpti: attainment, Viyoga: separation, Anyatva: otherness, differentiation, Dhṛti : sustenance ..Practice of the limbs of yoga is applicable as a cause for viyoga (separation of impurities) and apti (attainment of discriminative wisdom). Viveka-khyati is the complete opposite of avidya and is even more active. Discerning knowledge destroys our unwillingness to see the truth. It provides the courage to see the truth and gives us the strength and insight to see our deeply rooted habits (samskaras) and replace them with the samskaras of selfrealization (purusha-khyati/ atma-khyati). Discerning knowledge metamorphoses into an intense and irresistible desire (tiara samvega) to see and experience the absolute independence of consciousness (kaivalyam). The samskara created by this desire blocks all other desires. It grants us complete mastery over the mind and the subtle impressions deposited in the mind—as well as the binding and releasing forces of the mind that cause us to live in the world either miserably or happily. In other words, this knowledge contains an unprecedented level of revelation. When it dawns fully, the whole range of truth is available in its purity and perfection

2.29— yamaniyamasanapranayamapratyaharadharanadhy anasamadhayo-a-shtava anggani

Moral injunctions (yama), fixed observances (niyama), posture (asana), regulation of breath (pranayama), internalisation of the senses towards their source (pratyahara), concentration (dharana), meditation (dhyana) and absorption of consciousness in the self (samadhi), are the eight constituents of yoga.

This sutra sets out the eightfold path of yoga (astahgayoga), which Patanjali continues to describe in detail in the remaining sutras of sadhana pada. Restraints and observances that are bound by tradition and lineage follow uninterruptedly in the practice of yoga. Although asana, pranayama and pratyahara are separate entities, they depend on one another for expressing the hidden aspects of yoga. These stages, which enable the seeker to heighten in the art of yoga, are called progressive sadhana. Through them one achieves a higher and even more higher state. The first five aspects of yoga are individual efforts for the evolution of the consciousness, while dharana, dhyana and samadhi are the universal manifestation or the natural states of yoga (yoga svaritpa). The practice of yoga is an art and science dedicated to creating union between body, mind and spirit. Its objective is to assist the practitioner in using the breath and body to foster an awareness of ourselves as individualized beings intimately connected to the unified whole of creation. In short it is about making balance and creating equanimity so as to live in peace, good health and harmony with the greater whole. It is important to perform all the eight limbs successfully to attain the objective of yoga.

2.30— ahinsasatyasteyabrahmacharyaparigraha yamah

Non-violence, truth, abstention from stealing, continence, and absence of greed for possessions beyond one's need are the five pillars of yama.

The principle of yama involves wishing no harm in word, thought or deed; being sincere, truthful and honest; not stealing or misappropriating another's wealth or possessions; celibacy; and not accepting gifts or possessing only what one needs, without being avaricious. These rules and restraints are laid down clearly for one to live in society while remaining a yoga practitioner. The Yamas are nonviolence, truthfulness, refrainment from stealing, celibacy, and renunciation of ( unnecessary and superfluous )  possessions. The first two limbs that Patanjali describes are the fundamental ethical precepts called yamas, and the niyamas.   These can also be looked at as universal morality and personal observances. Yamas and niyamas are the suggestions given on how we should deal with people around us and our attitude toward ourselves. The attitude we have toward things and people outside ourselves is yama, how we relate to ourselves inwardly is niyama. Both are mostly concerned with how we use our energy in relationship to others and to ourselves. The yamas are broken down into five "wise characteristics." Rather than a list of dos and don’ts,  they tell us that our fundamental nature is compassionate, generous, honest and peaceful. Being the first limb of yoga, the five yamas are the foundation of spiritual life on which the super-structure of samadhi is built. Following the yamas means sticking to ideals and principles. It is about development of positive traits that will transform the human nature into a divine nature and annihilate cravings and negative qualities. When the yamas are truly practised, the heart is filled with cosmic love, goodness and light. There is a deliberate order in the five yamas. Ahimsa (non-violence) comes first because one must remove one’s brutal nature first. One must become non-violent and develop cosmic love. Only then does one become fit for the practice of yoga. Then comes satya or truthfulness. The whole phenomenon of maya or illusion is asat or unreal and the aspirant should be aware of this fact. He should ever remember the truth or Brahman. Next comes asteya or non-stealing. As one must develop moral consciousness, one must know right from wrong, righteousness from unrighteousness, and one must know that all is one. Brahmacharya or continence ( it has nothing to do with sex ) , which is the fourth yama, is a divine attribute. The aspirant is now becoming superhuman through its practice. The fifth is aparigraha, non-covetousness. The yogic student is now free from cravings, unnecessary wants, the desire to possess and enjoy, and his heart has expanded manifold.Yamas ( universal morality)  are as follows:-- 1. AHIMSA– Compassion for all living things. Ahimsa means you also do NOT approve of a evil man’s cruel actions of himsa and watch injustice as a coward and a impotent man—this is part of  ahimsa in its purest form. Ahimsa is not causing pain, not non-killing.. Himsa means to cause pain. Causing pain through words or thoughts can be even more harmful than killing. Ahimsa was the main theme of Gandhi’s non-cooperation movement in bringing freedom to India from the British. And he made sure that Jew Rotshchild robbed Bharatmata blind, while we ghumaaoed the charkha like napunksaks . Ahimsa as not injuring any living creature anywhere at any time within the perimeters of  dharma.  One must continue to perform one’s dharma even though it might mean killing , harmful enemies. Yogis should abstain from eating meat which involves nourishing one’s body by eating the flesh of other living beings. Being a vegetarian is an absolute requirement for an aspiring yogi. Ahimsa also encompasses giving up thoughts of malice and hatred as these produce tendency to hurt others through words or actions. The word ahimsa literally mean not to injure or show cruelty to any creature or any person in any way whatsoever. Ahimsa is, however, more than just lack of violence as adapted in yoga. It means kindness, friendliness, and thoughtful consideration of other people and things. It also has to do with our duties and responsibilities too. Ahimsa implies that in every situation we should adopt a considerate attitude . On the spiritual path, the first step is to eliminate the beastly nature. The predominant trait in beasts is cruelty; therefore, the wise sages prescribed ahimsa as the first yama. Ahimsa is positive love. It is to abstain from the slightest thought of harm to any living creature. The practitioner must abandon even unkind looks and scowls. There is no excuse or exception to the above rule. Harsh words to vulnerable people and  inferiors is himsa (cruelty). To fail to relieve pain or trouble in another is negative himsa. To approve of another’s harsh actions is also against ahimsa. So practise ahimsa in its purest form. 2. SATYA – Commitment to truthfulness . Speech should not be deceitful, misleading or devoid of value. It should benefit  and not harm anybody. As Manu says in his Manusmriti, "Let him not speak what is true but unkind; let him not speak what is kind but untrue". A common example quoted is the one from Mahabharata where when Drona asks of Yudhishthira (righteous son of dharma, known to speak the truth always) if his son, Ashwatthama was dead, Yudhishthira simply replied "yes, Ashwatthama is dead". This was truthful to the extent that the elephant by that name had died. However, the meaning conveyed to Drona was that his son had died. This is considered as misleading as it lead to great harm to Drona and his downfall. Satya means "to speak the truth," yet it is not always desirable to speak the truth on all occasions, for it could harm someone unnecessarily. We have to consider what we say, how we say it, and in what way it could affect others. If speaking the truth has negative consequences for another, then it is better to say nothing.  It is no use telling your wellwisher that you saw his mother in a whorehouse around the time he was conceived.  Satya should never come into conflict with our efforts to behave with ahimsa. This precept is based on the understanding that honest communication and action form the bedrock of any healthy relationship, community, or government, and that deliberate deception, exaggerations, and mistruths harm others.   Thought must agree with word and word with action. This is truthfulness. There is no room for hypocrisy. To think of one thing, say another and do another is nothing but crookedness. By telling lies you pollute your conscience and infect your subconscious mind. Truth means the strength to abide by positive principles. Speak the truth, but let it not be unpleasant and speak not any pleasing falsehood – this is eternal religion. It is said that if you speak the truth for twelve years, you will acquire vak siddhi, whatever you say will come to pass. There will be great power in your speech, you will be able to influence thousands. If you are established in truth, all other virtues will cling to you. Truth is like the brilliant sun, how long can you hide it ?   3. ASTEYA is not taking things belonging to others and not even having a desire to do so. Having a desire may ultimately lead one to stealing. Even if you find a treasure trove of jewels it should not be taken as it doesn’t belong to you. Steya means "to steal"; asteya is the opposite-to take nothing that does not belong to us. This also means that if we are in a situation where someone entrusts something to us or confides in us, we do not take advantage of him or her. Non-stealing includes not only taking what belongs to another without permission, but also using something for a different purpose to that intended, or beyond the time permitted by its owner.   The practice of asteya implies not taking anything that has not been freely given. This includes fostering a consciousness of how we ask for others’ time for inconsiderate behavior demanding another’s attention when not freely given is, in effect, stealing. Asteya is another form of self-restraint. Why does a person steal? He wants something. When he cannot get it by legitimate means, he steals it. Desire, thirst or trishna is the root cause of stealing. You remove a thing secretly without the knowledge of the owner and you do not want others to know of this act. This is stealing. Taking paper, pencil, etc. from the office is stealing. Hoarding too much money, eating too much, adding to your cravings are all forms of stealing. A yogic student must be free from all these forms of theft. Even a sensitive mind becomes blunt by continuous stealing. Even a little dirt, a little theft affects the mind of a yogic student seriously. He will have to be very careful. Then alone will he have success in yoga.  4. BRAHMACHARYA is sense control and sexual responsibility . It has nothing to do with abstaining from sex or a ridiculous withholding discharge of semen even when sexually aroused  ( like what Gandhi did , sleeping under the same blanket with naked underage girls). Brahmacharya does not necessarily imply celibacy as marital fidelity and dispassion from hedonism comes under brahmacharya .  Rather, it means responsible behavior with respect to our goal of moving toward the truth.  Brahmacharya is celibacy in thought, word and deed.  Brahmacharya is divine conduct.  Don't waste the sacred force by promiscuity in thought, word or deed. Be restrained with the opposite sex. Seek company of elevated souls. Dress and speak modestly. Shun pornography and crass sexual humor.  Swami Vivekananda gave us Jew Rothschild’s  bullshit — that power comes to him who observes unbroken Brahmacharya for a period of twelve years.  And he claimed he was one of those .  He wrote that complete sexual continence gives great intellectual and spiritual power and we can transform the sexual energy into spiritual energy- which  is pure bullshit.  Vivekananda attributed his phenomenal mental powers to a lifelong observance of brahmacharya (an extreme stage of irreversible sexual celibacy).   Sorry, this nonsense is not Sanatana Dharma. In his Raja Yoga, the Swami Vikananda gives bull - that through brahmacharya sex energy is converted into a higher form of psychic energy called ‘ojas.’ Ojas, literally meaning the ‘illuminating’ or ‘bright’ is the highest form of energy in the human body. In the spiritual aspirant who constantly practises continence and purity, other forms of energy are transmuted into ojas and stored in the brain, expressing as spiritual and intellectual power. Swami Vivekananda who claimed to be a brahmachari wrote “ A man who wants to be a perfect Yogi must give up the sex idea. The Soul has no sex; why should it degrade itself with sex ideas? –this is unadulterated bullshit which is not supported by Sananata Dharma. The white invader gave bull –that according to Ayurveda semen is the last Dhatu that is formed out of Majja or marrow. From food chyle (Rasa) is manufactured. Out of chyle comes blood (Rakta); out of blood comes flesh; out of flesh comes fat: out of fat comes marrow; out of marrow comes semen. These are the seven Dhatus.   Sorry, this bullshit is NOT Kerala Ayurveda. The most foul thing done was to encourage married men in Grihasta stage to practice Brahmacharya by sexual continence.   Gandhi used this lame lie , to discard his wife from his bedroom and take in a homosexual jew with an enema kit  .Later this German Jew was discarded to take in teenaged naked girls who would sleep with him under the same blanket and give Gandhi enema twice a day and vice versa. Rothschild got his fake and backdated Rishi Yajnavalkya to write:   “Brahmacharya is abstaining from sexual pleasure for ever, under all conditions and in all places, either physically, mentally or verbally.”Brahmacharya is about restraint ( avoiding looking down a plunging neckline ) and not suppression of sexual desire. In restraint no sexual thought will arise in the mind. What is wanted is restraint and not suppression of sexual desire. In restraint no sexual thought will arise in the mind. There is perfect sublimation of sexual energy. JEW ROTHSCHILD TRIED TO CREATE A SYSTEM WHERE HOMOSEXUALS WILL HIJACK HINDUISM, BY USING VIVEKANANDA TO PROPAGATE SEXUAL CELIBACY..EXACTLY THE WAY CATHOLIC CLERGY ARE BANNED FROM MARRYING. IT WONT WORK. ALL OUR MAHARISHIS WERE MARRIED. But in suppression the aspirant is not safe. When favourable opportunities occur, the repressed desire manifests with redoubled force and there is danger of a miserable downfall. What is wanted is deep inner life. Open yourself to higher spiritual consciousness. Feel the divine presence and divine guidance in your life.. Do not hide your thoughts. Pray for light, purity, strength, peace and knowledge. You will be established in brahmacharya. Kama refers to all the desires in man for the enjoyment and satisfaction and sensual gratification of the five human senses. Kama could be music or being creative or team spirit in sport or travelling to places of natural beauty or sitting with family at the beach or riding a fast horse or participating in a arrow shooting contest  - anything which brings delight to human life and spirit . It has absolutely nothing to do with lust and sexual orgasm.   Kama would refer to the totality of the innate desires and drives of man-  motivations of man. Kama refers to the instinctive and emotional life of man, and provides for the satisfaction of his aesthetic urges. Bhagavadgita rightly points out, "The objects of the senses turn away from the abstinent man leaving the longing behind, but this longing also turns away after he attains Self-realization".This has nothing to do with sex and semen alone. Anything in excess is bad.  Even too much drinking of water or too much oxygen or too much can kill a human being.In a broad sense, passion means any strong desire. In some children , there is an extra strong passion for video computer games . Passion done not mean a strong sexual appetite alone. This is a physical craving for instant gratification. Passion is a very strong desire.  A mild desire becomes a strong passion by frequent repetition or frequent enjoyment which leads to addiction. In old men and women, sexual passion gets suppressed naturally as long as the food is proper. It cannot do any havoc. It is only in young men and women who have reached adolescence that this passion becomes troublesome. This is why Sanatana Dharma has set a age for Vanaprasta ( 50 ) and Sanyasa stage ( 75 ) .In the vast majority of persons, the sexual craving is very intense.. In some, the sexual desire occasionally comes, but passes off quickly. There is mere agitation only, of a simple nature in the mind. By the proper method of spiritual Sadhana, this also can be completely eradicated. The whole idea of yoga is to harness such strong passions . Not marrying in grihasta stage or cutting off your balls to become a eunuch is not the solution. When you say , we must avoid car accidents while going to work, does not mean you stop working and stay at home. Only IDIOTS do this. You are expected to drive carefully in a sober manner  .

Digression: The planet’s first women’s lib and feminist Sulabha who won a debate with King Janaka ,the king of Mithila,  is a Jew Rothschild FAKE and backdated creation. Nobody in India heard of Sulabha till the white invader came to India ( like Radha, Ahalya, Meera etc ). This woman was used to establish that Ashwamedha Yagna is a blood sacrifice of a horse and the caste system of India existed in ancient days. At desh drohi literary fest they discuss this feminist woman Sulabha . Sulabha is also known as Maitreyi, the FAKE wife of the FAKE and backdated creation of Jew Rothschild Sage Yajnavalkya. Same way Gargi the Vedanta expert woman who debated with King Janaka is a FAKE and backdated creation of Jew Rothschild.  Women Ghosha and Lopamudra are also FAKE and backdated creations of Jew Rothschild

I do not consider Swami Vivekananda competent to speak about love . Brahmacharya is restraining from perverse lust and unnatural sex.  A brahmachari can make love to his wife whom he loves . A lot of fake gurus are homosexuals and claim to be brahmacharis just because in their passport there is no wife’s name. Homosexuals are notoriously unstable and unreliable.  Marriage and family  is the natural path for humans by will of god.   Today if you marry a chutnet Mary , she has nothing left to exchange for love but sex. Lust is just temporary commitment  that last only long enough to fulfill the base desire.  Lust is only interested is self pleasure as it is basically sexual greed. Lust is physical chemistry over a short period of time.  It is filled with desire, passion, acquisitiveness and intense animal emotions-everything which yoga tells to shun. Lust is what a man feels when he goes to a whore. Lust produces NO deep emotional bonding, what you feel when you love a person. Lust is an infatuation, while love keeps people together long after the infatuation has faded. . Love is an intense feeling of affection and care towards another person. If your partner is the first person that you think about when you want to share your innermost thoughts, then you may be in love. There is a great willingness to make sacrifices for another and working at settling differences. Love creates commitment to another and intentions are genuine intentions.  You don’t make an ass out of a person you love. Love fosters security, peace, inner happiness and a stable , solid partnership which can provide the ideal atmosphere to raise confident, content and secure children. Love is unconditional and the real deal. Love sees a bright future together . There is this feeling that your life would be totally empty without her. You want to introduce her to your family  . It becomes suddenly important to you that your parents like her, and that she gets along with everyone close to you.  You include her in all your plans . She challenges and motivates you.  She makes you happy, and you'd do anything to make her happy. If you’re truly hoping to find love, remember that love has to be nurtured like a plant. Lust is like a fart-breaking wind. Real love brings out the best in people. You know that it is LOVE when you do NOT need to get physical to feel connected to the other person. You feel complete and happy just holding her hand or talking to her. If at all you have sex with such a person you love, it is mind blowing literally an explosion of divine passion. Love accepts things as it is . The woman does NOT see the need to wear make up or put plastic in her tits to hold on to her man. In India no woman puts plastic in her tits ( or upper lip )  to hold on to her husband . The difference between love and lust is the attitude of your heart. If you’re in love, the attitude of your heart is one of selflessness, with the other person as your focus, whereas if you are in lust the attitude of your heart will be one of selfishness, with yourself as the focus. True love is driven by a divine desire to provide for, nurture and care for the other persons needs.  Love is when you want to do all you can for someone not expecting anything in return at all. We had Sri Sri Ravishankar promoting homosexuality recently. What does this unmarried man know of love. He calls himself a brahmachari, just because he is NOT married. Love is the foundation of stable societies—only. Yoga sustained stable societies. Lust is amazingly self serving, love is unlimited and unselfish,  and although love doesn't exclude lust, it's handy to know the difference between the two.   Sanatana Dharma has never promoted sexual repression.  No man could do a yagna unless he was married with a living wife.

Jew Rothschild made a Kerala Prince Raja Ravi Varma paint all his FAKE and backdated creations.  One is Ahalya. Ahalya is discussed like Radha in almost all desh drohi literary fests. They argue ( till the cows come home )  why Rama frees Ahalya from being cursed for adultery, but punishes his wife Sita over false accusations of adultery with her kidnapper, Ravana.FAKE sex starved adultress  Ahalya has been injected into a lot of our ancient scriptures.  In reality Ahalya is unploughed land which Indra made fertile. Ahilya, is the wife of the sage Gautama Maharishi. Many Hindu scriptures say that she was seduced by Indra (the king of gods), cursed by her husband for infidelity, and liberated from the curse by Rama (an avatar of the god Vishnu). Ahalya was married to the much older Gautama. In the earliest full narrative, when Indra comes disguised as her husband, Ahalya sees through his disguise but nevertheless accepts his advances. Later sources often absolve her of all guilt, describing how she falls prey to Indra's trickery. In all narratives, Ahalya and Indra are cursed by Gautama. Ahalya is cursed to become a stone and regains her human form after she is brushed by Rama's foot. The Bala Kanda mentions that Gautama spots  a hiding under the bed Indra ( in the form of a cat ), who is still in disguise, and curses him to lose his balls which injected sperm into his wife-. and to bear a thousand twats  on his body for good measure . At JNU the commie professors cooks up more and more masala every year.  How Ahalya turns back into stone after hearing that Sita had to undergo a trial by fire to prove her chastity. And the commie professors  even made Ahalya screw around with Surya.   How Ahalya’s daughter spilled the beans to her father Gautama , and how  an angry , Ahalya curses Anjani to give birth to a monkey –which is our Hanuman.. Rothschild used his agent Tagore to include Ahalya in his poems . Devadasis were made to dance on the Ahalya theme. Nobody in India heard of Ahalya till the white invader came to India. I learnt about Ahalya in my NCERT Hindi book of Kendriya Vidyalaya.

Vivekananda gave enough bull about Veerya and Ojas.

Veerya (Sanskrit वीर्य) literally means "state of a strong man" or "manliness.

Veerya is PSYCHOLOGIAL SPERM –not the drops of white gooey liquid which came out of Vivekananda's  prick. 

Mind, Prana and Veerya are under the one Sambandha or connection or circuit. If the mind is controlled, Prana and Veerya are controlled automatically. He who suspends or restrains Prana restrains also the working of the mind and the movement of the Veerya.  Again, if the Veerya is controlled, and if it is made to flow upwards into the brain by pure thoughts and the practice of Viparita Karani Mudras such as Sarvangasana and Sirshasana and Pranayama, the mind and the Prana are automatically controlled.

The simplest way to increase veerya is by Pranayama . It has a direct effect on our sex energy by freeing it from excitement and increasing its psychic potency.

According to Ayurveda, Ojas is the subtle essence that is responsible for life, radiant health, strong immunity, vigor, longevity and overall well being of an individual.  The subtle essence called ojas that is extracted from the proper digestion and efficient metabolism of food nourishes the bodily tissues of blood, plasma and lymph, muscle, fat, bones, bone marrow, semen and ojas.  Ojas also forms the basic material of the five sense organs, ligaments and lubricating fluids . 

The bull given by Vivekananda that by not ejaculating you preserve Ojas remains bull.   Vivekananda died at a very early age , and he had 31 major ailments in 38 years of his life--obviously I cant congratulate him.  If he says that he got HAJAAAAAR Ojas , by not ejaculating for 12 years , he must think again. 

He must know what is REAL Ojas as per 6200 year old Ayurveda.

Signs of healthy Ojas:

A person with healthy ojas possesses:---

Clear radiant complexion
Strong immunity against infectious disease      (seldom falls sick)
Cheerfulness, energy and enthusiasm,
High threshold for stress,
Mental clarity
Signs of weakened Ojas:

Signs of a person with weak ojas :---

Depressed and       always worried
Lacks luster/poor complexion
Poor appetite
Feel sluggish/fatigued
Suffers from disorders of the sense organs.-

Ojas is diminished by under eating, overeating, eating when previous food has not yet been digested, consumption of poor quality food that results in the blocking of the channels, consumption of stale foods, canned foods, fermented foods like cheese, meat, irregular diet, excessive exercise, fasting, negative emotional stressors such as anxiety, anger, sadness, grief, hatred, jealousy, long held resentment, fear, grief, consumption of alcohol, smoking,  lack of sleep, excessive discharge of mucus, blood, semen and other excreta, with age and injury by other organisms, undue exposure to wind and sun, excessive sexual activity. Since Ojas is the result of the quality of food we eat, its proper digestion and efficient metabolism and the sensory impressions we imbibe in our daily life, in order to protect ojas it is vital to protect the mind and heart from emotional strain and stress and to adopt a healthy balanced diet.

Nourish your physical health by eating meals in a pleasant environment in the company of people that you enjoy.
Eat at a moderate pace. Don’t eat in a hurry, while walking or driving.
Don’t eat when you are emotional, angry, upset etc.
Don’t eat if the previous meal still hasn’t been digested as that will lead to the production of ama/toxins. The accumulation      of ama in the bodily tissues leads to disease.
Eat a balance meal.  In Ayurveda, a balanced meal consists of      all the 6 major tastes in moderation: sweet, salty, sour, bitter,      astringent, and pungent.  People of      pitta constitutions should minimize or avoid hot, pungent, spicy foods as      that will further aggravate the pitta (internal fire) which could further      burn out the ojas.
Nourish your mind through regular meditation
Positive thinking

What is Tejas?

Tejas is responsible for inner radiance, glow or aura, luster in one’s eyes, clarity, fearlessness, courage, intelligence, and understanding and comprehension at the cellular level.  It is the subtle and positive essence or counterpart of pitta or fire element in the body and is responsible for the digestion and metabolism of everything we take in. Tejas can be compared to hormones and amino acids that regulate cellular metabolism.

Hence tejas is needed for metabolism.  If tejas in a person is too high it burns out the ojas (just as fire evaporates water), as in the case with multiple sclerosis.  The myelin sheaths which are composed of ojas (water element) are burned by high tejas (fire element).

Negative thinking damages ojas, tejas, prana, immune system, the spleen, the function of the lymphatic system.  The thymus gland is located very close to the heart which is the seat of emotions.  Hence any negative emotional disturbance will affect the thymus. Gently tapping the sternum stimulates the thymus gland which in turn stimulates the immune system.

Tejas gets diminished by:

Excessive talking
Psychological /emotional imbalances
Negative thinking
For a healthy balance of tejas one should:

Enforce positive thinking.  Positive thinking strengthens ojas, tejas and prana and the thymus gland, which is responsible for a healthy  immune system and good health.
Chant mantras
Try sitting in the meditation position, in a lotus pose as that helps open up the heart chakra, calms the breath and balances ojas, tejas and prana.
Practice awareness in thought, words and action
Avoid gossip, excessive talking, negative talk etc.

The prostate is a small gland located between a man's penis and his bladder. Its main function is to produce a thick white fluid that is mixed with the sperm produced by the testicles, to create semen.
 A healthy young man's body is still going to produce semen. And this semen needs to be regularly flushed from his body. If a man has a sick gland, it undoubtedly benefit from increased blood flow.
The gland itself requires some muscular contraction and/or massage to keep the blood flowing properly through it and flush out toxins . This is how it gets cleaned. It is because it is such a fine filter for the liquid that becomes semen that it collects so many toxins and becomes so susceptible to cancers. If sperm is regularly cleaned out to allow new cells to develop, it helps stop the build-up of old cells that might be more likely to turn cancerous.  There are yogic asanas which can do this job without ejaculation  or else you increase your risk of prostate cancer ( which Vivekananda had- so balls to his veerya and ojas -and one drop of semen is equivalent to 40 drops of blood BULL )

Self-control is not repression – it is balance and moderation, or the avoidance of excess. Regular and devoted spiritual practice quickly bestows great power, or Ojas Shakti (Sanskrit: vigor and energy), on the yogi. His aura increases. Ojas accumulates in, and radiates from, the astral body. This has nothing to do with semen power. Realised masters who have Ojas Shakti, can easily uplift and initiate others with mere look, touch, thought, or through the power of their speech. Ojas is spiritual energy that is stored up in the brain.  By sublime thoughts, meditation, japa (mantra repetition), worship and pranayama (breath control), the energy can be transmuted into Ojas Shakti and stored up in the brain.

Jew Rothschild used his FAKE and backdated creation Rishi Yajnavalkya to give BULL about sexual sublimation : "Brahmacharya is abstaining from sexual pleasure for ever, under all conditions and in all places, either physically, mentally or verbally. When semen is preserved, it gets reabsorbed by the body and stored in the brain as Ojas Shakti or spiritual power.  "Sorry it is NOT sexual energy which goes up from Mooladhara Chakra to Sahasrara Chakra via Kundalini raise.Just like how Tantra has been reduced to sex , shallow minded idiots have reduced Brahmacharya to sex ( veerya /semen power ).  Brahamacharya is about character building and self restraint. Brahmacharya is the very foundation of Yoga. Just as a house that is built on a weak foundation will surely collapse, so also you will fail in meditation if you are weak in Brahmacharya.Chakras are focal points where psychic forces and bodily functions interact with each other. They are transceivers of SCALAR energy. Scalar waves can produce a great repelling force on the atomic nucleus, bypassing the outer electron shells, directly engineering or interfering with the components of the nucleus. Scalar waves operate in a non-linear time dimension which is hyperspace, at any speed from zero to infinity, as they are not limited to the speed of light. Secondary fields caused by the motion of subatomic particles interacting with Zero Point Field or Aakasha or Ether are called Scalar waves. They are not electromagnetic and hence don’t have direction or spin. Scalar waves can travel faster than light. Scalar waves encode the information of space and time into a timeless spaceless quantum shorthand of interference patterns. Electrons get their energy to whiz around the nucleus of an atom without slowing down because they  tap quantum fluctuations of empty space.  The seven chakras cannot be seen by the sight sense of the common man. Each of these 7 chakras are associated with a specific colour, organ, gland, mantra and frequency. The lowest is Muladhara at the base of the spine, and the highest is Sahasrara at the top of your head. The crown Sahasrara chakra reaches down until its vortex touches the pineal gland. Kundalini starts its ascent towards the head center after responding to the vibrations from the 'light in the head. Introversion is neccessary for self-realization. Inner attention magnetizes “spiritual light” into the pineal gland. Human thought is the result of suspended action, and the pineal gland inhibits the immediate discharging of thoughts into action. This inhibition causes us to look inward and to deeply ponder our actions and reactions. When an area of quantum coherence collapses, an instant of consciousness occurs.  The Muladhara encircles a mysterious divine potency called Kundalini, which can be raised by Yoga and meditation, chakra by chakra, till it reaches the Sahasrara. A overwhelming bliss is felt , which mystically represents re-integration with Atman or the eternal essence of self. With awakened Kundalini telepathy is possible. Chakras can then send out information carrying Soliton waves, which do not attenuate.  The Indian sage has exploded into a space of consciousness in which inner awareness is spontaneous. Cosmic consciousness is an intellectual enlightenment or illumination, an undescribable state of moral and intellectual elevation, a feeling of amazing bliss. When your perception opens up you can talk to trees. When meditating if tingling happens in your body, it means some rearrangements are taking place in your energy. You can feel the influence of the chakras with the help of a pendulum, as it will start rotating on its own under the influence of any of the chakras when brought near that chakra’s field.  When these chakras are not spinning at their optimal speed, their respective characteristics can be adversely affected. Trying to suppress or deny emotions freely often results in blocks in the corresponding chakras--so do not hide your emotions from yourself, even if you decide for some reason to hide them from others. Reiki and chakra meditation are some of the ways to keep your chakras in youthful condition. When your chakras are out of balance nothing seems to go all right, and you have a sense of depression. You can douse your chakras with Tetrahydron Quartz. Dousing is the easiest of all ESP. Chakras contribute to your Aura. The real nervous system operates by means of synaptic messages. The virtual one operates by means of the quantum effect of tunneling (particles passing through an energy barrier that classically they should not be able to climb). The real one is driven by classical laws, the virtual one by quantum laws. Consciousness is therefore driven by quantum laws. With the advent of powerful new tools like femtosecond (10-15 second) lasers and nanoscale-precision positioning, life’s quantum dance is finally coming into view. Our creative power to reverse entropy and heal still lies within us. We all have stem cells in our body that can make new healthy cells. Life can re-create Life, NOW. All we need to do is neutralize the electromagnetic charges held in our fields that disrupt our natural state of perfection.  Planck's constant = (uncertainty in energy) x (uncertainty in position).Most of the various electronic devices of the past decades rely on the quantum.  In quantum physics all things are seen as possibility waves.  And it is consciousness that changes these possibility waves into actuality. Everything is made of energy, including thoughts, feelings, emotions, sensations, and associations. Remember, chakras dictate all physical, mental, emotional and spiritual processes that take place in your body. Every chakra is a transmitter cum receiver antenna. A vedic sage with 12 strand DNA and a king sized pineal gland , with chakras on overdrive and golden aura , can do wonders. There is a difference between a sage and a saint. This is very different from canonisation of saints by Vatican. Even the Chinks who died in Tiannman square are saints , as they have been canonised by the Pope. It is all about toeing a line. Politics and spiritual stuff are like oil and water--they do NOT mix. The seventh layer of aura ( which realized masters have ) represents the divine mind, and is made up of  high-frequency, bright golden energy lines. Extending three-and-a-half feet from the body, these golden lines form the matrix for all the physical components of our bodies. With a well developed seventh kosha, we start seeing and feeling the hidden divine perfection. A hidden purpose appears in every seemingly imperfect event or item around you, resulting in serenity of mind. At this level you hold your core beliefs, which may or may not be in harmony with the universal laws. All of our creative ideas flow from this level and give a sense of purpose to them. When the seventh kosha is underdeveloped, we might feel that everything is disconnected, random, chaotic and without purpose. When our beliefs are in disharmony with the divine laws, we are bound to experience diseases and upsets. This kosha holds the entire energy field together and protects it from harm. The Bija mantras are one-syllable seed sounds that, when said aloud, activate the energy of the chakras in order to purify & balance the mind & body. When you speak the bija mantras, you resonate with the energy of the associated chakra.--as mentioned in the  Jabala Darsana Upanishad in 5000 BC. The human body belongs to the microcosm , and it has a perfect equation with the macrocosm.   The human body could send scalar fields to hyperpace by actuating the Mobius coils in the DNA and the blood veins and arteries.The tantrics  knew the seven chakras of the human and their powerful equation with the macrocosm.  Tantrics hold the human body as the pinnacle of creation, and they spent their energies in unlocking these amazing secrets by hit and trial or by following a Guru who had already experienced everything. Fire whch cannot be polluted and which spreads upwards negating the law of gravity , is the centre of all Tantric rituals.  Tantrics can cure people with incurable diseases just by using holy ash from the fire he has meditated on.  This is done in conjunction with astrology and a bit of alchemy and a subtle connection with Akasha or the Zero Point Field . Tantra addresses all concerns of the body, mind and spirit.. Tantra has nothing to do with sex. The Internet is full of thousands of fake charlatan Tantrics wanting free screws with attractive women. Tantrics have always shunned the spotlight for millieniums, even by adopting unacceptable behavior when they see greedy disciples . Tantrics can sit in the middle of a venomous snake pit filled with hundreds of cobras and vipers and draw a circle around them, which no snake will transgress. Tantrics can maintain huge penile erections the whole day ( without think of sex )  in front of a cheering crowd and lift huge boulders with sheer prick power. In human beings, Shakti, the feminine aspect is called Kundalini.  This potential energy rests at the base of the spinal cord. The object of the Tantric practice of Kundalini-yoga is to awaken this cosmic energy and make it ascend through the psychic centres, the chakras, that lie along the axis of the spine as consciousness potentials. She will then unite above the crown of the head with Shiva the pure consciousness. This union is the aim of Kundalini-yoga: a resolution of duality into unity again, a fusion with the Absolute. By this union the adept attains liberation while living which is considered in Indian life to be the highest experience: an union of the individual with the universe. Kundalini awakened humans are provided with a life force beyond everyday understanding.  It allows them to fully experience their spiritual as well as worldly lives, as the line separating the two becomes almost nonexistent. Tantra carries us beyond the dualities of masculine and feminine.  By awakening our consciousness to ourselves, we awake our consciousness to the universe. We move beyond the dualities imposed by human minds. We move beyond the ego and for a moment, we experience pure bliss. The spiritual awakening of a sadhak is described in Tantra by means of the symbol of the awakening and rising of the Kundalini power. According to Tantra, the Kundalini, in the form of cosmic energy, is present, in everything, even in a particle of matter. When they first burst the nuclear bomb , they knew what was written in our 7000 year old texts.  Only a fraction of it, like the kinetic energy, is operative, while an unmeasured residuum is left, like the potential energy, ‘coiled up’ and untapped at the ‘base root’.  A specific ratio between the active and the total energies of the kundalini determines the present condition and behaviour of the bodily apparatus. A change in the ratio is necessary to effect a change in its present working efficiency by transforming the grosser bodily elements into finer. A transformation, dynamisation, and sublimination of the physical, mental, and vital apparatus is only possible through what is called the rousing of the Kundalini and its reorientation from ‘downward facing’ to ‘upward facing.’ The passage of the awakened Kundalini lies through the Sushumna, which is described as the central nerve in the nervous system. A kind of hollow canal, the Sushumna passes through the spinal column connecting the base centre (Chakra) at the bottom of the spine with the centre at the cerebrum. Tantra speaks of six centres (Chakras) through which Sushumna passes. In the ordinary worldly person these centres (Chakras) are closed, and the lotuses droop down like buds. As the Kundalini rises through the Sushumna Canal and touches the centres, these buds turn upward as fully opened flowers and the aspirant obtains spiritual experiences. The goal in spiritual practice is to make the Kundalini ascend from the centres, which are lower and more veiled to those which are higher and more conscious.. At this sixth centre (the two-petalled white lotus located at the junction of the eyebrows) the jiva sheds its ego and burns the seed of duality, and its higher self rises from the ashes of its lower self. It now dies physically, as it were, in order to be able to live in pure consciousness. The sixth centre is the key by which the power in the thousand-petalled lotus in the cerebrum, which is like the limitless ocean, is switched on to the little reservoir which is the individual self, filling the latter and making it overflow and cease to be the little reservoir. Finally the Kundalini rises to the lotus at the cerebrum and becomes united with Shiva, or the Absolute, and the aspirant realises, in the transcendental experience, his union with Siva-Sakti ( PURUSHA / PRAKRITI ) . The opening of the petals of the thousand-petalled lotus, which endows the illumined person with omniscience, is equivalent to the functioning of all the brain cells of a yogi in samadhi-- the open third eye. Kundalini which exhibits pronounced psychic and trans-temporal effects is the 'channel' that connects the unmanifest void, with the manifest world of subatomics, atoms, molecules and cells and is the cellular expression of energy generated from the vacuum .Kundalini buffers the harshness of bare reality.  Increased heart field and EMF of the nervous system during the peak Kundalini, acts like a biological synchrotron to actually change certain elements in the central nervous system into their high spin monatomic state.  Scalar waves  encode the information of space and time into a timeless, spaceless quantum shorthand of interference patterns.  Kundalini has the  effect of stimulating an increased flow of ions upping the body’s dipole and increasing the EMF. Tantra acceptance comes out of  a deep contentment -- not out of  frustration, repression and helplessness.







Vivekananda wrote that sexual abstinence brings psychic advancement. Oh yeah?  Tell that to the TATTUS who cant get it up, leave alone fire blanks !  The days of holding an unmarried (homosexual  wearing saffron robes ) man in great esteem is now over !

Here is something mindboggling nonsense written by a guru ( Sivananda Saraswati who was unmarried  ) , about a brahmachari who does not lose semen.
QUOTE:  It is the basis for morality. It is the basis for eternal life. It is a spring flower that exhales immortality from its petals. It is the substratum for a life of peace in Atman. It is the firm support for Brahma-Nishtha, which is eagerly longed for by sages, aspirants and Yogic students. It is the shield for waging war against the internal Asuras—lust, anger and greed. It serves as a gateway to the bliss beyond. It opens the door of Moksha. It contributes to perennial joy, to the uninterrupted and undecaying bliss. Even Rishis, Devas, Gandharvas and Kinnaras serve at the feet of a true Brahmachari. Even Isvara applies to his forehead the dust of the feet of a genuine celibate. Brahmacharya is the only key to open the Sushumna and awaken Kundalini. It brings glory, fame, virtue and Mana-Pratishtha. The eight Siddhis and the nine Riddhis roll under the feet of the true celibate. They are ever ready to obey his command. The Lord of Death flees from him. Who can describe the magnanimity, majesty and glory of a true Brahmachari !  There is nothing in the three worlds that cannot be attained by a Brahmachari. The Rishis of yore knew fully well the value of Brahmacharya and that is the reason why they sang in beautiful verses about the glory of Brahmacharya.  Just as the oil comes up in a wick and burns with glowing light, so also, the Veerya or semen flows up by the practice of Yoga Sadhana and is converted into Tejas or Ojas. ! UNQUOTE


Brahmacharya is not merely the life of celibacy, but the purification of all the senses. The practice of brahmacharya is the vow of abstinence for all sense objects, in particular mentally.  Overeating, oversleeping, overtalking and dwelling on, or longing for sense objects are all breaks in brahmacharya. Purity and freedom from lust in thought, word and deed is an essential part of the vow. If you are on the path of the divine, you are a brahmachari. TATTUS who cant or wont ejaculate are not brahmacharis. Brahmacharya is not limited to or defined by sexual activity: it is the practice of mastering and conserving our vital energy. Patanjali states that energy is conserved when we remove our attention from the sense pleasures and conserve it.  We lose the capacity for spontaneous joy when we spend our energy seeking pleasure. Brahmacharya as “continence of body, speech, and mind.” Continence is self-restraint. Brahmacharya dictates that we learn to quiet the mind and reduce or eliminate unnecessary thought so that we have the full mental capacity to devote to spiritual awakening. Restraining and conserving our life force through all our thoughts, words, and actions is a tall order. This is why I translate Brahmacharya as “mastery of our energies”. It is NOT about being a TATTU and holding on to you semen voluntarily or involuntarily—or not marrying a woman ( just because you are a homosexual ). A lot of our famous FAKE gurus who have NOT married are homosexuals—their school classmates reveal this.It takes many years of dedication and practice to establish oneself in Brahmacharya. It requires us to master all of our behaviors, rather than allow them to unconsciously drive us. It necessitates that we have total volition over our minds and emotions. Thoughts and feelings will still come and go, but we must learn to be unattached to what arises and able to release it at will. Established in Brahmacharya one develops a fund of vitality and energy, a courageous mind, and a powerful intellect… Brahmacharya is the battery that sparks the torch of wisdom.

Jew Rothschild created and backdated the FAKE Anusuya the mother of the FAKE Dattatreya ( 3 in 1 trinity god ).

Check out how Jew Rothschild tried to make monkeys out of Hindus

Let me quote Wikipedia-
QUOTE:  The sage Narada praised Anusuya in his hymns and verses, making the wives of Brahma, Vishnu and Shiva jealous. They requested their husbands go and tempt her away from her husband, breaking her pativrata. The Divine Trinity went to Anusuya as guests when Atri was not at home, and asked her to serve them lunch in the nude. She agreed, but first splashed them each with enchanted water, turning them into small children. The three goddesses waited for their husbands to return, and when they didn’t, traveled to Anusuya’s cottage to find them transformed. The goddesses repented, and at the request of Anusuya, the three Gods agreed to be born as her sons. According to one version, the gods merged turning into Anasuya's three headed son Dattatreya.UNQUOTE


If the sexual energy is transmuted into  spiritual energy by pure thoughts, it is called sex sublimation . Sublimation is not a matter of suppression or repression, but a positive, dynamic, conversion process. It is the process of controlling the sex energy, conserving it, then diverting it into higher channels, and finally, converting it into spiritual energy or Ojas Sakti. By entertaining sublime, soul-elevating thoughts of the Self or Atman, by meditation, Japa, worship and Pranayama, the sexual energy can be transmuted into Ojas Sakti and stored up in the brain. Yogis can even control thirst and hunger –leave alone lustful sexual thoughts. According to Yogic science, prostaglandins exists in a subtle form throughout the whole body. The Yogi penetrates into the subtle hidden nature of things through Yogic Chakshu or the inner vision of wisdom. The Yogi gets control over the astral nature of semen and thereby prevents the formation of the very fluid itself. The body of a man who is truly an Oordhvaretas has the scent of a lotus. The process of sex sublimation is extremely difficult. It demands constant and protracted Sadhana and perfect discipline. That Yogi who has achieved perfect sublimation has perfect control over lust. Complete sublimation is achieved through ceaseless meditation on Atman and Self-realization. That Yogi or Jnani who has attained the highest Nirvikalpa Samadhi, in whom the seeds of Samskaras are fried in toto, can claim to be a perfect Oordhvaretas or one who has complete sex sublimation. There is no fear of his downfall. He is perfectly safe. He will be absolutely free from impurity. This stage is a very high stage. A microscopic minority only have attained this sublime exalted state.An example of a full Oordhvareta Yogi is Adi Shankaracharya--his body had the fragrance of a lotus flower .











Rahul menon
July 25, 2016 at 9:03 AM

Respected Sir,

The demo was something like this

Is this just a marketing gimmick? Or does this have some real science behind it?

Please share your wisdom on this topic.


Capt. Ajit Vadakayil
July 25, 2016 at 10:29 AM



Triple Sri called for a volunteer to come up on stage for a “patented” magic oil surprise demonstration.

One of the students from the back rows of the auditorium was chosen to share the dais.

The chosen volunteer, a male student wearing a black t-shirt with horizontal white stripes, was asked to extend his arm parallel to the floor, clinch his fist and resist the pulling down of his arm.

Triple Sri gripping the volunteer’s arm near the wrist, was able to pull down his arm easily over and over again, much to the amusement of the naïve audience.

He then produced from his pocket a small vial containing some oil.

The volunteer was then asked to rub and spread this oil over his arm. After the volunteer took a step back and a deep breath to relax, the whole exercise was repeated again – except this time Triple Sri with his gargantuan paunch struggled quite hard to pull down the volunteer’s arm, amazing the vast audience.

The volunteer, visibly impressed and believing that he had in fact become stronger in a matter of seconds after the application of the oil, went onto fall at the feet (cultural practice of surrender) of the extraordinary messiah Triple Sri.

Following the thundering applause from his gullible audience, Mr. Ravishankar went on to urge stronger volunteers to come forth.

The next male volunteer also went on to fall at the feet of Mr. Ravishankar after his new found strength.

The frenzy in the arena attracted a male "skeptic" from the audience to volunteer.

He was visibly unimpressed by the arm pull down test and the claim of instantaneous improvement of strength and vigor following the application of a few drops of oil.

The skeptic boldly asked for permission to perform the same test on his own test subject on the dais.

While the skeptic readied his subjects, Triple Sri changed his track and launched into a astounding theory for his precious oil.

He spAke “one drop of poison can destroy the body. Can it not destroy? One drop of poison can destroy the immune system. No? HOOO ? No ? The reverse can also happen – one drop of nectar can also strengthen your body.”

The stupefied audience gaped in awe.

What happened afterwards was most hilarious . The “test subjects” chosen by the “skeptic” gave testimonies to the audience that they felt “something different,” and the skeptic had to agree, on the microphone, that he was convinced of the power of the messiah and his great oil.

The gullible IIT Kanpur audience could NOT stop clapping. These are the same folks AAP’s Kumar Vishwas recites mindless non-veg Hindi poetry ( CHOO LAA is this poetry, is he a poet ? ) and gets these rustic North Indians in raptures.

Some Shakthi Drops, are sold for 25 Euros in 30ml vials on Art of Living’s EU website.

Triple Sri uses the reaction principle to trick all. Push , relax a muscle and then pull.

Triple Sri’s oil which gives rocket boost in immunity and muscle strength is not even pseudo science – it is sheer fraud.



capt ajit vadakayil

Dear Captain,

As usual, excellent write up. A request to you, if you can spare time.

You have written "Lack of spiritual understanding = Avidya". Please provide a similar definition of Vidya.

You have also written

IX: They enter into blind darkness who worship Avidya (ignorance and delusion); they fall, as it were, into greater darkness who worship Vidya (knowledge).

X :By Vidya one end is attained; by Avidya, another. Thus we have heard from the wise men who taught this.

XI: He who knows at the same time both Vidya and Avidya, crosses over death by Avidya and attains immortality through Vidya.

My question is -How Avidya helps in crossing over death and how Vidya helps in getting immortality whereas in previous lines perils of following Avidya and Vidya has been highlighted ?

I could not understand the concept. It will be helpful if you can illustrate these points more.











    even today all praise gandhi for his brahmacharya -- they give hajaaar thaali --see gandhi slept with underage girls under the same blanket and never got a HOP leave alone ejaculate


    when you step off empire state building, you will fall and die 100%

    this PROFOUND truth cannot be at the mercy of lesser truths--of MAY BE -MAY BE NOT ..


    capt ajit vadakayil is a living legend at sea, because he explained concepts in a very clear manner using SEX and SHIT and FART

    sailors loved it -- as they could understand most complex matters in a jiffy







    capt ajit vadakayil

5. APARIGRAHA is renunciation of unnecessary possessions.Aparigraha is the ability to see the problems caused by acquisition, preservation, and destruction of things, since these provoke attachment and injury. Possessions produce samskaras which activate in the future to cause distress if we can’t acquire items desired by us or losing the items that we possess. Yogis are advised to acquire only what is required for basic maintenance and give up all else. Parigraha is covetousness or greed. Aparigraha is a mental state in which the sensual craving is dead. Parigraha leads to anxiety to preserve, fear of loss, hatred, anger, untruthfulness, stealing, etc. Aparigraha puts an end to all these and bestows peace and contentment. It removes at one stroke fear, attachment, disappointment, anxiety, jealousy, anger, lust and depression. Aparigraha is indeed an aid to the practice of ahimsa, satya and asteya. When the craving is not satisfied you become angry, you hate the person who stands in your way of attaining things. You harm him in different ways, speak untruth and begin to steal things. Aparigraha removes all these. It is the foundation of all yogas, just as dhyana or meditation is the meeting point of all yogas. Neutralizing the desire to acquire and hoard wealth . The yamas are the moral virtues which, if attended to, purify human nature and contribute to health and happiness of society. Yoga is rooted in the notion of developing a positive personality. Therefore ethical discipline or the practice of correct conduct is necessary for success in yoga. This is the basis of yama and niyama, the two moral backbones of yoga. They define the attributes to be practised in everyday life by a spiritual aspirant. Yama is the first limb of Patanjali’s ashtanga yoga and means ‘taking a vow’ while niyama is the second limb and means ‘rule of conduct’. Yama and niyama are inter-dependent. Niyama strengthens and safeguards yama. For example, if one is contented, one will not steal, hurt others or tell lies and will find it easy to practise non-covetousness.  When one is sufficiently advanced in the practices of yamas and niyamas, one can face every temptation by calling in the aid of pure and restraining thoughts. When the mind becomes pure it attains the state of steadiness and becomes one-pointed. If these positive qualities are not cultivated, the mind cannot be led to steadiness. One needs to be well established in yama-niyama to attain perfection in yoga. When one is perfectly established in them, samadhi will come by itself.

2.31— jatideshakalasamayanavachchhinnah sarvabhauma mahavratam

Yamas are the great, mighty, universal vows, unconditioned by place, time and class.

In this sutra Patanjali emphasizes  that the five yamas are absolute, non-negotiable and universal for yogis and cannot be exempted under any circumstance such as class, place, time, or circumstance. The five components of yama are called 'mighty universal vows', because they are not trammeled to class, place, time or notion of duty. They must be followed unconditionally by everyone, and by students of yoga particularly, irrespective of origin and situation, with a reservation concerning cultural phenomena like religious ceremonies, vows and vocations of certain people. They form the skeleton of rules on which society is grounded. It is however of the belief that this universal approach should be applied to all the other component stages of yoga, without discrimination of time, place or circumstances, to lay down the principles of a universal culture. For full-time, dedicated yogis, these vows (of yamas) are not be broken under any circumstance limited by time, place, purpose, social or caste rules, winter, summer, morning, evening etc. For yogis not committed to their yogic goals, these vows can be modified according to their position in life. There are exceptions to yamas.  A fisherman due to his occupation needs to inflict violence only on fish but nowhere else. Kshatriyas, the warrior class,  are allowed violence for protecting the watan from evil invaders who want to loot, rape women and make people slaves.  We Indians were slaves for 800 years , first to invading Muslims and then to the white Christian.  Jew Rothschild had his agent Gandhi telling us to ghumao charka while the white invader robbed Bharatmata blind and converted India from the riches  to the poorest in 250 years flat.. Gandhi cheated Bharatmata.  As per Patanjali, if a Kshatriya wishes to be a yogi, he must abandon violence altogether even though it may be condoned based on some sacred scriptures. In the Karma-yoga section of Bhagavad Gita, Krishna exhorts Arjuna to do his duty as a Kshatriya and engage in violent warfare and kill his near and dear . This may be acceptable in a socio-civic context, but must be renounced in an ascetic path of yoga. It may be argued that once avidya (ignorance) has been removed, one can act from a position of enlightenment and may engage in violence in certain circumstances (war, for example); however, Patanjali makes it clear that no such exception can be made for one on the path to enlightenment. Patanjali would like to make it clear that even though one’s dharma may dictate violating one or more of these yamas, for a yogi they must be treated as great vows, never to be violated. Yamas, and its complement, Niyamas, represent a series of "right living" or ethical rules.  They are a form of moral imperatives, commandments, rules or goals. The Yamas are the "don't do these" list of self-restraints, typically representing commitments that affect one's relations with others and self. The complementary Niyamas represent the "do these" list of observances, and together Yamas and Niyamas are personal obligations to live well. The earliest mention of the word Yamas is in the 7000 year old Rigveda. The Yamas apply broadly and include self-restraints in one's actions, words and thoughts. Yama is the very foundation of Yoga, without which the superstructure of Yoga cannot be built. Practice of Yama is really the practice of Sadachara (right conduct). Manu says: Ahimsa satyasteyam sauchamindriya nigraha - harmlessness, truth speaking, refraining from theft, control of senses; this is the essence of Dharma. Great emphasis is given in every chapter of the Gita on the practice of Yama. The ten yamas listed by Śāṇḍilya Upanishad, are:--Ahiṃsā (अहिंसा): Nonviolence,Satya (सत्य): truthfulness,Asteya (अस्तेय): not stealing,Brahmacharya (ब्रह्मचर्य): chastity,marital fidelity or sexual restraint,Kṣamā (क्षमा): forgiveness,Dhṛti (धृति): fortitude, Dayā (दया): compassion,Ārjava (आर्जव): non-hypocrisy, sincerity,Mitāhāra (मितहार): measured diet, Śauca (शौच): purity, cleanliness

2.32--- shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah

Cleanliness, contentment, religious zeal, self-study and surrender of the self to the supreme Self or God are the niyamas.

Niyama evolves from individual practices, necessary to build up the sadhaka's own character. These five observations harmonise with the five sheaths of man and the elements of nature - the anatomical (earth), physiological (water), psychological (fire), intellectual (air) and spiritual (ether) layers.   As ether (mahat akasa) is considered as an empty space outside, therefore the soul is an empty space within and is called cit-akasa.  In reality this empty space is a zero point field , a PLENUM, a cauldron  of brimming energy .The principles of niyama that are comprehended by kriyayoga accentuate the importance of self-discipline. Mastery of yoga would be unattainable without the observance of the ethical principles of yama and niyama. Cleanliness or purification is of two kinds - external and internal. Both are necessary. Taking a bath is external purification; performing asanas and pranayama is internal cleanliness. Observance of niyama develops friendliness, compassion and indifference, and is a further aid in purging the body, mind and intelligence. Svadhyaya is checking oneself to see if the principles of yoga are being followed. In order to follow these principles one has first to decide whether one's own pattern of behaviour is coordinated with them or not. If not, one has to prepare one's thoughts and actions in conformity with them, and remove those faults which hinder one's sadhana. Owing to desires, anger, avarice, infatuation, haughtiness and envy, the mind is immersed in pain. Misguided by these emotions, the sadhaka loses his balance of mind and behaves immorally. Re-examination of his thoughts reduces the inclination to be wrong. The ethical discipline of yama and niyama transform the sadhaka's alloyed or corrupted mind and enables his consciousness to radiate in its own unalloyed pureness. Hence, yoga stresses that discipline is religion .It is a method knowingly designed to elevate each individual's awareness so that he may experience the vision of the core of his being - atma darsana. religion is the means to Self-Realisation. Whereas yamas are concerned with how the yogi interacts with others by desisting from certain activities, niyamas focus on personal discipline and practice by engaging in certain activities. 
1)SHAUCHA is both internal and external cleanliness. External cleanliness consists in hygiene . Internal cleanliness consists of purifying the mind of contaminations like anger, hatred, jealousy, pride, vanity, attachments etc. An attitude of friendliness and compassion toward all will help internal purity.  For external cleansing yogis recommend the practice of the Shatkarma (six cleansing routines) mentioned in the Hatha Yoga Pradipika: Dhauti (internal cleansing), Basti (yogic enema),Neti (nasal cleansing),Trataka (concentrated gazing), Nauli (abdominal churning), Kapalabhati ( forehead glow).In sutra 1.33. Six "mental impurities" are commonly mentioned – kama (lust/craving), krodha (anger), lobha (greed), moha (delusion), mada  (arrogance), and matsarya (jealousy). The ultimate internal cleansing involves removing all the five kleshas by the attainment of "viveka khyati" (discriminative discernment). Saucha is  purity, clearness of mind, speech and body.The practices of asana, pranayama and meditation cleanse and purify the body and mind, as well as strengthening their capacity to maintain a pure state of being. We must also consciously work at surrounding ourselves with a pure environment . Shaucha is the doorway to deeper and more tranquil states of meditation. As the body becomes purified you will experience radiant health; as the mind becomes purified you will feel increasingly clear, friendly, and cheerful. The first Niyama is about nourishing ourselves through the five senses of taste, touch, sight, sound, and smell. Everything we take in from the environment flows through these channels and is then perceived as our experience. Here, we are encouraged to reduce or eliminate anything we may distinguish as being toxic, and increase things that provide more nourishment for our body, mind, and soul. Consider the foods you're eating, your habits, the environment you spend most of your time in, and the relationships you have with others. Weed out the habits that don’t support a life of purity.  2)SANTOSHA or contentment is a great wealth. When the mind is happy because of the light of sattva guna, that is santosha. You count your blessings, not your sorrows. Santosha represents disinterest in accumulating more than one’s immediate needs of life. The Bhagavad Gita makes a strong statement against desires that can never be satisfied. To avoid injury to the foot from thorns, one only needs to wear a pair of shoes – there should be no need to cover the entire earth with carpets.When the mind is happy because of the light of sattva guna, that is contentment. It is about unbound optimism in life , acceptance of others and of one's circumstances as they are.  Dont be so focused on things you want that you miss things you need. Human tendency is to want more and more things that you really don’t need.  Never allow things you want to obscure things you have. Never let things that matter the most be at the mercy of things that matter the least. Stop chasing useless things you want and your soul will get what it needs . Santosha is not craving for what we do not have as well as not coveting the possessions of others. The yogis tell us that when we are perfectly content with all that life gives us, then we attain true joy and happiness. It is easy for the mind to become fooled into thinking that we can attain lasting happiness through the possession of objects and goods, but both our personal experience and the teachings of the sages prove that the happiness gained through materialism and hedonism is only temporary. Practicing contentment frees us from the unnecessary suffering of always wanting things to be different, and instead fills us with gratitude and joy for all of life’s blessings.When we are content, we are happy. This second Niyama invites us to relinquish patterns of trying to control other people and outcomes, and to settle, instead, into a place of centered awareness. Yoga is the progressive quieting of the fluctuations of the mind. When you settle into periods of quieting the mind, you will experience a state of contentment that reflects your ability to remain at peace regardless of what is going on in your external environment., you will be filled with contentment and gratitude for the beauty and gifts that are abundant in your life.  3)TAPAS – Tapas is doing something you do not want to do that will have a positive effect on your life. When our will conflicts with the desire of our mind an internal “fire” is created which illuminates and burns up our mental and physical impurities. This inner fire can also be used as a source of spiritual energy;. Tapas transforms and purifies us as well as enables the conscious awareness and control over our unconscious impulses and poor behavior. Tapas builds the will power and personal strength to help us become more dedicated to our practice of yoga . Tapas (discipline) is the third Niyama, and it’s often incorrectly perceived as having to refrain from life's pleasures. As human beings, we are meant to experience all aspects of our humanity, including from the physical, material, mental, emotional, spiritual, and ethereal. This Niyama is about creating a strong and balanced foundation from which the other Niyamas may flourish. Yoga involves enduring hardships and remain undisturbed by the lack of material comforts. Tapas does not mean inflicting undue and damaging hardship on the body. Just like gold is purified by putting it through intense heat, the same way our body and mind are purified by practicing tapas., making a determination to give up your normal comforts for a certain amount of time is a part of tapas. The practice of asanas is a form of tapas for the body; meditation is a tapas that purifies and focuses the mind. Self-surrender is not a process of defeat or of mindlessly submitting to another’s will. It is the act of giving ourselves to a higher purpose. Eating healthy, organic foods; committing to daily movement or exercise; getting to sleep by 10 p.m. and waking at sunrise; and committing to silence and self-reflective practices are some of the disciplined daily practices that establish a solid foundation for personal care. 4)  SVADHYAYA is study of self, self-reflection, introspection of self's thoughts, speeches and actions. Svadhyaya means, literally, “to recollect (to remember, to contemplate, to meditate on) the Self.” It is the effort to know the Self that shines as the innermost core of your being.By the practice of Svadhyay, desire for worldly objects diminishes and taste for spirituality increases. Chanting of mantra as a form of Swadhyay. Svadhyaya (self-study) is the ability to see our true divine nature through the contemplation of our life’s lessons and through the meditation on the truths revealed by seers and sages. Life presents an endless opportunity to learn about ourselves; our flaws and weaknesses give us the opportunity to grow and our mistakes allow us to learn. Examining our actions becomes a mirror to see our conscious and unconscious motives, thoughts, and desires more clearly. The yogic practice of Svadhyaya also involves the study of sacred and spiritual texts as a guide to our interior world where our true self resides. Self-study requires both seeing who we are in the moment and seeing beyond our current state to realize our connection with the divine. Reading spiritual literature ( like Bhagawad Gita ) will give you some level of intellectual knowledge. It’s just as important to develop spiritual awareness through self-study, which will provide you with an experiential understanding of the knowledge you've acquired intellectually. When knowledge and experience come together, wisdom is born.  
5) ISHVARA PRANIDHANA - Ishvara refers to all-pervading consciousness; pranidhana means “to surrender.” Self-surrender is not a process of defeat or of mindlessly submitting to another’s will. It is the act of giving ourselves to a higher purpose.  Ishvara Pranidhana is contemplation of the Ishvara ( Brahman, True Self ).  . Through this simple act of dedication we become reminded of our connection to our higher power, and our yoga practice becomes sacred and filled with grace, inner peace, and abounding love. Embracing uncertainty is one of the most challenging practices and yet, the paradox of surrendering to uncertainty is precisely what sets us free from limitless constrictions of the mind. Practice accepting the outcome of events and situations—even when they don't unfold in the way you had hoped.  Ishvara Pranidhana is a mindset , an attitude to calm the mind.-------The five niyamas are constructive tools for cultivating happiness and self-confidence; the opportunities to practice them arise every day Niyama literally means positive duties or observances—it includes virtuous habits, behaviors and observances (the "dos").The second limb of Patanjali’s eight-limbed yoga system contains the five internal practices of Niyama (observance). These practices extend the ethical codes of conduct provided in his first limb, the yamas, to the practicing yogi’s internal environment of body, mind and spirit. The practice of Niyama helps us maintain a positive environment in which to grow, and gives us the self-discipline and inner-strength necessary to progress along the path of yoga.When you pick one petal from the garland of yamas and niyamas, the entire garland will follow.The word "yoga" means to unite the three layers of our existence: body, mind, and spirit. The practice of cultivating higher levels of personal conduct begins with self-awareness. Niyamas will emerge naturally when you live a balanced life on spiritual, mental, emotion, and physical levels.   The Niyamas are about your individual personal behavior and they serve as a guide for recognizing and improving how you're living—and loving—when no one is looking. The Niyamas invite us to consider how we live our lives when no one else is paying attention. This is way different from Sadguru Jaggi Vasudev telling Barkha Dutt on TV , that as long as homosexuality is done behind closed doors –all is OK.  This rogue does NOT want to lose his Freemason sponsorship . Karma catches up behind closed doors too.

July 26, 2016 at 5:50 AM


Your points about this hype on celibacy by some gurus(Vivekanand,etc) is spot on!
Infact many years ago I had read that "Brahmacharya" means being/living in/near Brahma, not withholding semen.

However, one point needs clarity- wasn't the system of Dashnami Sanyasis and taking Sanyas Deeksha started by Adi Shankaracharya himself ??

Even Vivekananda was initiated into Dashnami Sanyas order. These are the ten orders who give Sanyas with surnames like "Giri", Saraswati", etc.

So, why did Adi Shankaracharya make this system of Sanyas for people of Grahastha age/ Brahmcharya age??


Capt. Ajit Vadakayil
July 26, 2016 at 9:53 AM

hi d,

The white invader wrote that Adi Shankaracharya established the Dasanami Sampradaya 1200 years ago.    Adi Shankaracharya died 4000 years ago.

Crypto JEW homosexuals were put as Shankaracharyas of FAKE and backdated mutts created by Jew Rothschild. Sanatana Dharma was hijacked by agents of the white invader.

They started celibacy ( with women only ), untouchability, animal sacrifices, devadasis , sati , aghori, and all fake traditions. In the four original mutts set up by Adi Shankaracharya only Namboodiris were allowed as heads or acharyas .

Before the white invader came to India we never heard of sects like Aranya, Ashrama, Bharati, Giri, Parvata, Puri, Sarasvati, Sagara, Tirtha, and Vana. Adi Shankaracharya had nothing to do with this dashnami sampradaya.

Dashnami sannyasins of above sects wore ochre-coloured robes and put CREMATION PYRE ASH on their foreheads- an unimaginable thing in Sanatana Dharma .
The white invader wrote LIES that the 4 original mutts were for dashnami sects
1. Govardhana Puri (Vana / Aranya )
2. Dvaraka Pitha ( Tirtha, Aashram )
3. Jyotirmath Pitha, Badrinath ( Giri, Parvat, Sagar)
4. Sringeri Sharada Peetha ( Puri,Saraswati , Bharathi )

Puri, Saraswati, Bharati : Bhaveswa
Tirtha, Ashram : Adhigata
Ban, Aranya : Kashyap
Giri, Parvat, Sagar : Bhrigu







capt ajit vadakayil


In his celebrated work "Vivekachudamani,"  Adi Sankaracharya, wrote that Brahmacharya or spotless chastity is the best of all penance. This has nothing to do with withholding semen .
QUOTE:  If, indeed, thou hast a craving for liberation, shun sense-objects from a good distance as thou wouldst do poison, and always cultivate carefully the nectar-like virtues of contentment, compassion, forgiveness, straight-forwardness, calmness and self-control. One should become aware of oneself, indivisible and perfect like Space itself, when free from identification with such things as one's body, senses, functions, mind and sense of doership, which are all the products of one's own ignorance. Only he who is free from the terrible hankering after the senses which is so hard to overcome is fit for liberation, and no-one else, not even if he is an expert in the six branches of scripture. The pleasures and riches of worldly life are deceptive appearances. Understanding that they are all but a passing-show, be detached and dispassionate, cultivate renunciation and seek Brahman. The first step to Liberation is the extreme aversion to all perishable things, then follow calmness, self-control, forbearance, and the utter relinquishment of all work enjoined in the Scriptures. Sense-objects are even more virulent in their evil effects than the poison of the cobra. Poison kills one who takes it, but those others kill one who even looks at them through the eyes. He who has killed the shark known as sense-object with the sword of mature dispassion, crosses the ocean of Samsara, free from all obstacles. So for a seeker after Liberation the infatuation over things like the body is a dire death. He who has thoroughly conquered this deserves the state of Freedom. Blessed indeed are those virtuous persons who at first have this consciousness of Brahman and then develop it more and more. They are respected everywhere. Recognise that the pleasures of sense-objects (samsara) are riddled with pain.Seek the Self with consistent endeavour. :UNQUOTE










When you say Bhakti you surely mean Bhakti movements and fake heroes and not Bhakti per se right? If so I amend one of my previous comments where I said Bhakti is Bakwas. I meant fake movements too.













    BALLS !




    capt ajit vadakayil







    1. This refldcts 'sanskar'of owners and employees. ..

    2. This reflects 'Sanskar' of owner and employees















    1) BBC -- 667 MILLION



    1. We are all waiting and ready to support and dive in with you Capt. Just ask for it

    2. Yes and it will keep on growing more


    BALLS !




  7. hi capt
    wat is this FLAT EARTH THEORY ? look at this web
    SINCE U HAVE SAILED THE SEA DO U BELIVE EARTH IS FLAT LIKE, guy from this website. eric dubay argues otherwise.





    2. Mishraji is still stuck in contemplating whether the earth is falt or round!!! Height of ignorance boss!!!

  8. Captain
    Your view on Baba Bulleh Shah?

  9. Dear Sir,
    The Zircon hypersonic missiles could also be added to the arsenal.The next world war will be about technology and information. Russia Creating Cutting-Edge Universal Nuclear Battleship.

  10. i have said to myself that water would come at ramalingam temple at buggapur which is between sadasivpet and tandur route of telangana and to my surprise water came ,where there were no rains in telangana until july 17 but rains came afterwards and pond near the temple was full . it was revived after 25 -30 years.












  13. Dear captain,
    An off topic question, is it true staying in a house which is near to high tension tower will cause cancer or brain tumor because of the EMF transmitted by the cables. The house distance is about 30 metres from the tower cable.

    Thank you,

  14. Sir ,
    can u guide me through your blog
    1) Lord Parshuram (an avatar ) was a shiva devotee ??
    2) Is Vishnupuran authentic or fake ??
    3) What is the link between Lord Hanuman & Lord Shiva ??
    Please do explain in detail.

    1. Captain never answers my questions on Hanumanji ....either he doesn't know or he deliberatly avoiding the topic. Without Hanuman how can ramayan be complete!! Even Valmiki Ramayan has Hanuman in it. He says that Shiva has no Avatara but in common psyche Hanumanji is related to Shiva. Hope that Captain clears the fog on this issue instead of simply saying "Shiva has no Avatara". We need more information if at all he has and is sure of it.

    2. Hanuman is pavan putra, so not a avatar of shiva.

  15. If East India Company braught the evil of tea, opium, cigarettes alcool to Bharat , please throw some light on history of coffee in the country. Here is what Wikipedia has

  16. Replies
    1. Prostaglandins are natural chemicals (lipids ) in the body with hormone-like qualities. First discovered in semen, prostaglandins were later found in cells throughout the body. Prostaglandins have been synthesized and used in injections to help men with erectile dysfunction (ED) obtain an erection. ED occurs when a man consistently can't get an erection or maintain one long enough to engage in sexual intercourse.
      While most hormones are released by a gland and then carried throughout the body in the bloodstream, prostaglandins are not. Rather, they're produced at the area of the body where they're needed. During womens period, prostaglandins trigger muscles in the uterus to contract. These contractions help expel the uterus lining. When pregnant women go into labor, prostaglandins help cause the cervix to dilate and contractions to occur.

  17. Hi Ajit,
    A new movement called Pinjra Tod is just started in Delhi and all Lal Salam Women propagating this to divide the delicate fabric of Society:

    With best wishes,

    Sushanta Das


    2. Hi Ajit,

      LOL ,good terminology BTM !!!

      Sushanta Das

  18. Captainji,

    What is ur opinion on this?

    Thank you.




      before 7000 BC, india ruled the whole world ,and there was only ONE religion -- hindusim.

      muniyaras or dolmen are seen all over the world--exactly like the ones you see in kerala.

      you can put the word DOLMEN is google search and then go to "images" to see the similarity.

      in hinduism SAGES who have attained moksha are buried .

      in the olden days this burial was in a mound over the ground, with a dolmen as the main skeleton structure -- NOT under the ground .

      the earth and smaller stones around has been washed away--over time

      the waitress pooh poohed ayodhya and ram temple as myths -- but koreans wanted to adopt ayodhya.

      punch into google search-

      korea has maximum muniyaras on this planet.

      putting structures together is by manpower and the use of levers..

      capt ajit vadakayil














    1. R is taunting the Gods to challenge him. Women entering Sabarimala should be the last straw of these satanists (anti-nature --> anti-God). We have seen divine retribution (Kedarnath flood) yet the evil forces much longer can the centre hold?

  23. Captain people are saying Ajit Doval made Nepal PM resign. Can India pull off such big task with such short time?


      JNU student ali zeidan became PM of libya

      JNU student baburam bhattarai became PM of nepal

      why modi govt is soft on JNU commie professors-- which force ties up his hands ---this blogsite knows!


      capt ajit vadakayil

  24. How come vishnu avatar ram and parshuram lived at the same time?

  25. Awesome Sir, It is great.. thank you so much for your blessings




    one way if we consider Bhisma and Bhagwan Ayappa our ancestors their vow must be respected by people of bharat being their children.














      capt ajit vadakayil

  26. Dear Captain,

    As usual, excellent write up. A request to you, if you can spare time.

    You have written "Lack of spiritual understanding = Avidya". Please provide a similar definition of Vidya.

    You have also written

    IX: They enter into blind darkness who worship Avidya (ignorance and delusion); they fall, as it were, into greater darkness who worship Vidya (knowledge).

    X :By Vidya one end is attained; by Avidya, another. Thus we have heard from the wise men who taught this.

    XI: He who knows at the same time both Vidya and Avidya, crosses over death by Avidya and attains immortality through Vidya.

    My question is -How Avidya helps in crossing over death and how Vidya helps in getting immortality whereas in previous lines perils of following Avidya and Vidya has been highlighted ?

    I could not understand the concept. It will be helpful if you can illustrate these points more.











      even today all praise gandhi for his brahmacharya -- they give hajaaar thali --see gandhi slept with underage girls under the same blanket and never got a HOP leave alone ejaculate


      when you step off empire state building, you will fall and die 100%

      this PROFOUND truth cannot be at the mercy of lesser truths--of MAY BE -MAY BE NOT ..


      capt ajit vadakayil is a living legend at sea, because he explained concepts in a very clear manner using SEX and SHIT and FART

      sailors loved it -- as they could understand most complex matters in a jiffy







      capt ajit vadakayil

    2. Sir
      're query on Vidya avidya...
      One describes Brahman Or purusha
      Other the prakriti both have different properties just as a sack of rice can be cleaned by knowing either rice or pebbles removing pebbles only rice remains n vice versa.Avidya is ignorance about soul but it'is knowledge of all material substances .

    3. Thanks to both of you. Now I think I am getting some sense of it

  27. O ignorant Hindus!!! Read below how your ancient civilization is being beaten black and blue and subtly raped in the intellectual brothel from all sides while you remain asleep in the degrading spell of materialism and consumerism.
    Few days back I purchased IGNOU Booklet on Ethics. Most of the chapters are authored by Christian Professors. Even the chapter on Contemporary Indian Ethics is also authored by a Christian professor who as a tribute has included a chapter on Ethics of Amrtya Sen ( Yes, the same Amrtya of Nalanda University fraud fame reported in newspapers and blogs).
    All the references are from western authors who also include Wendy Doniger ( Yes same Wendy who paint Hindus and their civilization as sexual perversion)
    Whole education system has been hijacked by Chrislamist Mafia having Doctorate degrees to make naïve Hindus feel the authenticity of the source!! Ofcourse one would say, come on man!!! It is written by a PhD.
    Congratulations you “savage” “uncivilized” hindus for allowing your own culture being raped. Keep it up!!! And yea don’t forget to wear a western dress or TShirt with the flag of England on it!!! Don’t forget to cheer the Queen of England too!!!! Keep it up!!!

    Prithvi Singh

  28. Respected Sir,

    I recently came across a guy from Aizen Company who did a demo for me regarding a magnetic bracelet (This have been around in the west for long). He was pitching on the positive energy of the magnetic bracelet which can heal your body in many ways. The Demo he did was some few balancing exercises with and without wearing the bracelet. Of course I couldn't question him back because the demo somehow did work at that time. He says the magnet rectifies your body energy imbalances. I am not convinced at all on this.

    I did google about this, and people says it is fake. ex:

    The demo was something like this

    Is this just a marketing gimmick? Or does this have some real science behind it?

    Please share your wisdom on this topic.



      Triple Sri called for a volunteer to come up on stage for a “patented” magic oil surprise demonstration.

      One of the students from the back rows of the auditorium was chosen to share the dais.

      The chosen volunteer, a male student wearing a black t-shirt with horizontal white stripes, was asked to extend his arm parallel to the floor, clinch his fist and resist the pulling down of his arm.

      Triple Sri gripping the volunteer’s arm near the wrist, was able to pull down his arm easily over and over again, much to the amusement of the naïve audience.

      He then produced from his pocket a small vial containing some oil.

      The volunteer was then asked to rub and spread this oil over his arm. After the volunteer took a step back and a deep breath to relax, the whole exercise was repeated again – except this time Triple Sri with his gargantuan paunch struggled quite hard to pull down the volunteer’s arm, amazing the vast audience.

      The volunteer, visibly impressed and believing that he had in fact become stronger in a matter of seconds after the application of the oil, went onto fall at the feet (cultural practice of surrender) of the extraordinary messiah Triple Sri.

      Following the thundering applause from his gullible audience, Mr. Ravishankar went on to urge stronger volunteers to come forth.

      The next male volunteer also went on to fall at the feet of Mr. Ravishankar after his new found strength.

      The frenzy in the arena attracted a male "skeptic" from the audience to volunteer.

      He was visibly unimpressed by the arm pull down test and the claim of instantaneous improvement of strength and vigor following the application of a few drops of oil.

      The skeptic boldly asked for permission to perform the same test on his own test subject on the dais.

      While the skeptic readied his subjects, Triple Sri changed his track and launched into a astounding theory for his precious oil.

      He spAke “one drop of poison can destroy the body. Can it not destroy? One drop of poison can destroy the immune system. No? HOOO ? No ? The reverse can also happen – one drop of nectar can also strengthen your body.”

      The stupefied audience gaped in awe.

      What happened afterwards was most hilarious . The “test subjects” chosen by the “skeptic” gave testimonies to the audience that they felt “something different,” and the skeptic had to agree, on the microphone, that he was convinced of the power of the messiah and his great oil.

      The gullible IIT Kanpur audience could NOT stop clapping. These are the same folks AAP’s Kumar Vishwas recites mindless non-veg Hindi poetry ( CHOO LAA is this poetry, is he a poet ? ) and gets these rustic North Indians in raptures.

      Some Shakthi Drops, are sold for 25 Euros in 30ml vials on Art of Living’s EU website.

      Triple Sri uses the reaction principle to trick all. Push , relax a muscle and then pull.

      Triple Sri’s oil which gives rocket boost in immunity and muscle strength is not even pseudo science – it is sheer fraud.



      capt ajit vadakayil


    Read the glory of a Guru. This is for readers and not captain. Captain himself is a Guru and knows far more than what is written in this.

    My humble bow to the glorious tradition of Guru parampara.

    1. please add these too






    capt ajit vadakayil



    1. This is what goes on at TOI iffice , Delhi



  33. IMF flags decelerating pace of reforms in India

    so now IMF wants to make reforms in India ,and what IMF is doing in China ?

  34. abhishek prasannan
    July 5, 2016 at 12:33 PM


    Who is this Veluthachan?

    Capt. Ajit Vadakayil
    July 5, 2016 at 1:25 PM

    hi ap,









    Rahul Eashwar did Global Leadership at the London School of Economics—and he is being groomed to be a SICKULAR Hindu leader.



    STORY: In order to protect and conduct rituals at these temples, from the banks of the holy river Krishna, he brought two brothers who were Tapasvis (ascetic persons who have undergone rigorous rituals of Tapas). This was sometime in the year 301 AD. The rights of Thantries were conferred on these two brothers of the families of Thazhamon and Tharananallur. Thazhamon family was given hereditary rights to the the Dharma Sastha temples while the Tharananallur family was given hereditary rights to the other temples. In order to distinguish who has the rights to which temple, the horizontal staff of the Holy Flag Post (Kodimaram) of each temple controlled by the Thazhamon family points to the North, while that of Tharananallur family points to the South.

    As to how the names Thazhamon and Taranallur came into being, here is the story:-

    When Parashuram was escorting these two elected pure brahmins ( TELUGU PURITY-- TEEE HEEEE )to the new land of Kerala, he came across a river. He thought it an ideal time to test the abilities of the two brahmins. He asked both to cross the river. The first one walked across the water. `Taranam' in Sanskrit means `traverse' or `cross'. Because he traversed the water, he and his successors earned the name of `Tarananallur'. The second brahmin made the waters part and traversed through the river bed. `Thazhamon' means the sand at the bottom. He and his successors earned the name of `Thazhamon`and the title of `Kantar'. Thazhamon Madom thantries were given charge of the Sastha temples while the Tarananallur thantires were assigned to the Devi temples, especially in north Kerala. UNQUOTE

    Capt ajit vadakayil

  35. Rahul Gandhi SLEEPING in Parliament: The Newshour Debate (20th July 2016) -

  36. HAri Om Ajitaji
    In one of your replies you said that
    “Donating Eyes is Good Karma”
    But here in my place people are donating their bodies to the prestigious hospital. The craze is so much that, we read it every day in our local news papers, as if they are Local Heroes.
    After reading these news snippets in papers, even my parents are requesting me to donate their bodies. (They already donated their eyes)
    This body donation spree started after a local famous Dr. donated his own body n the son dissected his body in the prestigious hospital, gaining a worldwide attention as the First person & so on.
    I have read your “RIP impossible” blog post n understood when we die we get cremated n get rebirth after successful shoot up of our Soul.
    In view of the above kindly enlighten us which is the correct thing to do.
    As more n more people are running behind this fast moving train called “BODY DONATION”
    Hari OM

  37. capt.ji.
    you r writing the truth. but the truth makes me more confused. i am from kerala and would reciprocate most of your feelings.
    but even with all its draw-backs, i think even the marxian ideology has immensely helped in re-structuring the then existed fuedel set-up in kerala through land / educational reforms. lakhs of down-trodden people became direct beneficiaries and no-body could deny role of communists. this was like leaders EMS/AKG did prayaschitha for the henious sins committed by their fore-fathers against down-trodden people.
    but thinking on the other-side the strict caste hierachial structure has made kings out of ordinary people. no-where else in india one will be able to find skilled workers, artisans,carpenters,black/gold smiths and with their scientific back-ground in doing their traditional works they found it very easy to transit to modern technical jobs like fitters/electricians a notch above people from other nationalities or their counterparts from other parts of india. this makes them stand apart and as you know is the reason why keralites are at par with european standards as far as health/ education/life style etc. are considered.
    this way i cannot whisk away either marxism or hinduism. this dilemma seems to exists in most hindu keralites and the first feeling often seems to sub-due the latter.
    due to this,even i cant say a hariom, charan sparsh to you but in no way lesser gratitude than others.

    (RS) a typical keralite
















      Bose, wrote in his book INDIAN STRUGGLE (published in 1935 in London), that India needed a political system that was a mix of fascism and communism — ( samyavad ) . He was a fan of Mussolini , Rothschild's agent..

      Bose went all the way to Rome in 1935 to present a copy of above book to Italian dictator Benito Mussolini. Rothschild was present in that function.


      Gandhi, RIDICULED Bose and wrote that it looked worse than Bertram Mills circus.

      In 1938, at the 51st session of the INC at Haripura. Bose was the president.



      Bose sat on a chariot drawn by 54 bullocks, accompanied by 54 women in saffron saris, after a two-hour procession through 54 gates ..

      Bose repeated this ridiculous pompous affair in Southeast Asia when he took charge of Indian National Army and Indian Independence League.

      In October 1943, Bose announced the formation of Arzi Hukumat-i-Azad Hind and he shocked all when he promoted himself as head of state, prime minister, and minister for war and foreign affairs .





      Bose spoke to Japanese students of Tokyo University in 1944 , -- -India needs to have a philosophy that should be a synthesis between national socialism (Nazism) and communism. . .



      Punch into Google search - - -
      . . . . . . . .. . NETAJI SUBHASH CHANDRA BOSE , UNTOLD SECRETS OF RABAUL TUNNELS VADAKAYIL .. . . . . . . . . . . .
      capt ajit vadakayil

    3. capt.ji.
      in kerala communist evoke mostly EMS/AKG in their meetings. now-a-days marx/engles are not that often heard even though the party is named after former. they also remind people of atrocities of feudal days. even during my younger days (90s) i had over-heard some elders of bye-gone era referring to some old local fuedel petty lord as thampuran and the latter responding as cheruma (like some low-life creature). then one of my aged uncles told that the situation was much worse much earlier like the one which u had mentioned in racial biagotary of namboodiris post. even the language used to refer these people was like "neeli pettu" as if she had delivered some cat or dog rather than the term "prasavam". if not for communism what option was left for these people abused over centuries. at-least we can take solace of the fact that these people didnt convert en-masse into christianity/islam in Gods Own Country.
      i am not questioning your wisdom but realising the fact that we weere forced to embrace an unknown monster in place of a lesser devil. but the things needs to be properly explained. like those who created the social fissure at this lowest level are always left out of discussions and only this poor religion (??) is left to defend for it-self. really it is because our dharma structure has no agenda like others. every body just exploited it to their whims and fancies.
      so please continue to expose these people as they deserve no sympathy. all those who had killed the soul of this great nation.


    5. i didn't pay enough attention earlier to this line


      OMG !! this is insane , did bose had a hand in sastri's assasination ?? he had connections with CIA ? what the hell ? Captain please reveal the entire truth

    6. Capt has stated in his posts cannot reveal everything as it can be dangerous









  41. the rothschilds and the vatican have officially taken over the USA using the Jesuit owned Pentagon










  45. Hi Captain,
    Can you please guid,what single mantra one should recite?
    I mean to say if I want to choose a single mantra then which one it should be?

  46. Hi captain,
    Are all-out liquidators(to kill mosquitoes) harmful for health?

  47. Respected ajit sir,
    Former NATO commander 'behind failed coup against Erdogan' – Turkish daily

    Gunjan arya

  48. Captain,

    Your points about this hype on celibacy by some gurus(Vivekanand,etc) is spot on!
    Infact many years ago I had read that "Brahmacharya" means being/living in/near Brahma, not withholding semen.

    However, one point needs clarity- wasn't the system of Dashnami Sanyasis and taking Sanyas Deeksha started by Adi Shankaracharya himself ??

    Even Vivekananda was initiated into Dashnami Sanyas order. These are the ten orders who give Sanyas with surnames like "Giri", Saraswati", etc.

    So, why did Adi Shankaracharya make this system of Sanyas for people of Grahastha age/ Brahmcharya age??


    1. hi d,

      The white invader wrote that Adi Shankaracharya established the Dasanami Sampradaya 1200 years ago. Di Shankaracharya died 4000 years ago.

      Crypto JEW homosexuals were put as Shankaracharyas of FAKE and backdated mutts created by Jew Rothschild. Sanatana Dharma was hijacked by agents of the white invader.

      They started celibacy ( with women only ), untouchability, animal sacrifices, devadasis , sati , aghori, and all fake traditions. In the four original mutts set up by Adi Shankaracharya only Namboodiris were allowed as heads or acharyas .

      Before the white invader came to India we never heard of sects like Aranya, Ashrama, Bharati, Giri, Parvata, Puri, Sarasvati, Sagara, Tirtha, and Vana. Adi Shankaracharya had nothing to do with this dashnami sampradaya.

      Dashnami sannyasins of above sects wore ochre-coloured robes and put CREMATION PYRE ASH on their foreheads.
      The white invader wrote LIES that the 4 original mutts were for dashnami sects
      1. Govardhana Puri (Vana / Aranya )
      2. Dvaraka Pitha ( Tirtha, Aashram )
      3. Jyotirmath Pitha, Badrinath ( Giri, Parvat, Sagar)
      4. Sringeri Sharada Peetha ( Puri,Saraswati , Bharathi )

      Puri, Saraswati, Bharati : Bhaveswa
      Tirtha, Ashram : Adhigata
      Ban, Aranya : Kashyap
      Giri, Parvat, Sagar : Bhrigu







      capt ajit vadakayil

    2. hi D
      i am from the holy land where sankara was born. the mutt in kalady is under administration of kanchi kamakotipeedam. this mutt is run by tamil brahmins, the same people, who were despised by malayali brahmins (to which adi-sankara belonged), as out-siders/out castes . was it due to professional jealousy or what i dont know. may be captain will be knowing. but it appears to me that both were equally knowledgable as far a temple rituals,music or litreture was concerned and racists too. but still TB adopted sankara as their own and efforts are being made to look like sankara is a TB born in kumbakonam and kanchi mutt was founded by adi-sankara in 800AD and the mutt is being run by his followers/descendents. this is extreme deceit within hinduism by TB to settle their scores with MB for some-thing which happened in past. the MB are fewer in numbers now and most of their mysterious illams/manas (dwelling houses) are in dilapidated conditions due to their poor financial conditions. this is the price they had paid for not being submissive to our ex-rulers like TB. the TB on the other hand occupied almost all administrative post in erst-while kochin-travancore regions and prospered also. they were adequately rewarded by the british and some of them won nobel prizes also like for certain discoveries some of which were already known to indians like vibgyor effect and black hole (kali- which means empty in malayalam).
      some of these things i realized after reading captains blogs but which i already knew??

    3. hi rs,

      the white invader created the FAKE and back dated kanchi mutt -- and put adi shankaracharya as its first acharya

      the white invader dated adi shankaracharya's death as 477 BC.

      QUOTE: The chronological list of Guru Paramapara of the matham follows:[citation needed]

      Adi Sankara Bhagavatpada (482 BC-477 BC)
      Suresvaracharya (477 BC-407 BC)
      Sarvajnatman (407 BC-367 BC)

      but as usual they screwed up the dates

      the same wikipedia records adi shankaracharya death at 820 AD ( NEARLY 13 CENTURIES LATER )




      capt ajit vadakayil

  49. DRAK
    July 26, 2016 at 5:50 AM


    Your points about this hype on celibacy by some gurus(Vivekanand,etc) is spot on!
    Infact many years ago I had read that "Brahmacharya" means being/living in/near Brahma, not withholding semen.

    However, one point needs clarity- wasn't the system of Dashnami Sanyasis and taking Sanyas Deeksha started by Adi Shankaracharya himself ??

    Even Vivekananda was initiated into Dashnami Sanyas order. These are the ten orders who give Sanyas with surnames like "Giri", Saraswati", etc.

    So, why did Adi Shankaracharya make this system of Sanyas for people of Grahastha age/ Brahmcharya age??


    Capt. Ajit Vadakayil
    July 26, 2016 at 9:53 AM

    hi d,

    The white invader wrote that Adi Shankaracharya established the Dasanami Sampradaya 1200 years ago. Adi Shankaracharya died 4000 years ago.

    Crypto JEW homosexuals were put as Shankaracharyas of FAKE and backdated mutts created by Jew Rothschild. Sanatana Dharma was hijacked by agents of the white invader.

    They started celibacy ( with women only ), untouchability, animal sacrifices, devadasis , sati , aghori, and all fake traditions. In the four original mutts set up by Adi Shankaracharya only Namboodiris were allowed as heads or acharyas .

    Before the white invader came to India we never heard of sects like Aranya, Ashrama, Bharati, Giri, Parvata, Puri, Sarasvati, Sagara, Tirtha, and Vana. Adi Shankaracharya had nothing to do with this dashnami sampradaya.

    Dashnami sannyasins of above sects wore ochre-coloured robes and put CREMATION PYRE ASH on their foreheads- an unimaginable thing in Sanatana Dharma .
    The white invader wrote LIES that the 4 original mutts were for dashnami sects
    1. Govardhana Puri (Vana / Aranya )
    2. Dvaraka Pitha ( Tirtha, Aashram )
    3. Jyotirmath Pitha, Badrinath ( Giri, Parvat, Sagar)
    4. Sringeri Sharada Peetha ( Puri,Saraswati , Bharathi )

    Puri, Saraswati, Bharati : Bhaveswa
    Tirtha, Ashram : Adhigata
    Ban, Aranya : Kashyap
    Giri, Parvat, Sagar : Bhrigu







    capt ajit vadakayil

    1. so vivekananda was a homo humping brahmachari who died due to chrons and not because his 'shakti' was overflowing so much that he couldnt hold on to the physical body anymore as he claims [sounds familiar to mr sjv who is vivekananda 2.0]

    2. Hi Ajit,


      I think this is easy way to know

      With best wishes,

      Sushanta Das

    3. Captain do you mean vivekanda was a crypto Jew .. Who was chosen to represent india at the world religions conference .

    4. Thank you for detailed reply.


  50. Hi Captain ..... what is shakitpat diksha?? Also is Lord Shiva (who is a allegory) different from Lord Shankar??


    1. there are FAKE Siddha Gurus who claim to be able to give shaktipat diksha-- for INSTANT kundalini raise.


  51. Captain,

    Is there any difference between black beads mangalsutra / Kariyamani & yellow threaded mangalyasutra ? Which one is better any significance ? Requesting you a post on importance of indian wedding traditions and its significance .

  52. Dear Capt Ajit sir,

    There is a wellknown ancient Sanskrit text called "Sri Chakra". It is a book on acupuncture. In this text, there is a mention of Taste.

    Taste is known as vedic Taste, since time immemorial. It is mentioned in many vedic texts as one among five Tanmatras. Taste is made out of pancha bhuthas & ida-pingala. Acupuncture is also a therapy of pancha bhuthas & ida-pingala. Hence, it offers simple, easy, effective, safe and drug-free treatment.

    According to Sri Chakra text, there are six tastes - sour, bitter, sweet, pungent, astringent and salty. Taste also represents seasons and six - elements.

    Five-elements or six-elements?
    Yes, we always say five-elements. How come six?

    Sri Chakra says there are six Tastes. It means one more element is added here. It is tridosha. Hence six-tastes and six-elements.

    Acupuncture tells that one should like/eat all the six tastes; although it also recommends to eat sweet and salt to a minimum. Japanese eat less salt, hence they live longer. If one doesn't like a particular Taste or likes a particular Taste too much, then the disharmony of health occurs and requires therapy. A little more desire to eat a particular Taste is ok; but not too much.
    Can you please write a blog on vedic acupuncture in detail....thanks in advance.

    1. Capt has increased his revelation upto 19% by telling that oil pulling is for tongue and taste buds not just teeths it makes sense to me...there is so much to learn from our own country

  53. captain !

    You were right , when you said that Pakistan gvt is aware of ROTHSCHILD , i think u mentioned this when pakistan hadnt participated during YEMEN crisis.

    please , see this tweet..PAK NSA SARTAAJ AZIZ admitting about ROTHSCHILD and knows that Facebook CEO Zuckerberg is Zionist Rothscild..hence advising his government to ban FB in pakistan

    i think PAK NSA is well informed than our DOVAL who remains busy doing PR for free mason Vivekanada..

    You are proved right everytime..

  54. Thank you for the detailed reply, Captain.

    It clears up many things- I was aware that Rawal/Priests of Kedarnath are from Kerala (Namboodari) but wasn't aware of how Shankaracharyas fit in!

    One small point more Captain- what about seers like Orpheus? You mentioned he was an Indian sage and was celibate, the Greeks were also confused by his celibacy.

    Was he an exceptional case of a Superman sage or was he not a celibate but a family man? Please throw some light.




  55. Captainji,

    Please say on this Kolbrin bible.

    Thank you.

  56. Ancient Indians Preferred Dark Skin Not Fair Skin

    Hopefully Indians will wake up soon and realize what Real Beauty means



  58. Hello Sir

    Big respect to you sir what blog awesome it is

    Can show me certain proofs or evidence which prove that hinduism is oldest religion on earth...

    i need proof or images hinduism is older than 5000bc...9000bc ...long

    ihave a debate next week in colg

    Thank you///Jai shri krishna

    1. Google narasimha idol VADAKAYIL n kalpavigraha Vadakayil

  59. Dear Capt Ajit Sir,

    It's high time we focus on bringing down the judiciary...what's this....banned Ganeshotsav in Mumbai ?
    Let's make these 2 judges - division bench of justice Abhay Oka and justice Revati Mohite-Dere pay for this judgement and make them the icons of corrupt and anti-Indian culture judges....pls take this up and give more focus to clear this kachda sooner sir.

  60. Respected ajit sir,
    Sir why ther is too much of attack on all around the globe. lot of ppl are loosing ther life.doesnt matters wheather he is hindu Muslim Christian. As a human being my heart bleeds when I see lot of ppl dying nd nobody cares.every day hundred or may be thousands of ppl are dying fr some foolish reason or someone personal greed. Most of the ppl dont give a shit abt massacre. How can a human degrade to this level. I feel sorry that I not able to stop this adharama.
    Sir is there any way to stop this.

    Gunjan arya

  61. Hello Sir.

    Can you please shed light on the events of 1947 Roswell UFO crash? Have we been visited by organisms/entities from outside our planet and is the US government (and illuminati) covering this up? Please do answer, I request you.

    1. Please learn how to read Capt comments section by typing in Google and vadakayil. He has put very interesting comments on this topic. No UFOs......Russinas flew mutated humans over US to scare the shit out of them lol

  62. dearest captain

    can you read minds of people who are communicating with you through your



  63. chk this out Sir .. looks like some Low in IQ kind of race coming to Mumbai

  64. Dear Sir,

    You have written that Crohn's disease is monopolised by Jews.

    I did an internet search for symptoms of that disease. It tells the following -

    Symptoms related to inflammation of the GI tract:

    - Persistent Diarrhea
    - Rectal bleeding
    - Urgent need to move bowels
    - Abdominal cramps and pain
    - Sensation of incomplete evacuation
    - Constipation (can lead to bowel obstruction)

    I do find some symptoms that do matches in my case Occasionally ( sometimes rectal bleeding, sometimes constipation). Does that mean I have a Jewish ancestry at some side (maternal/paternal sides) ? BTW, I am Bengali and have gastric problems which may create these problems too.





  65. Hi Captain,
    Are you fine? My prayers and wishes for you and your family. Please come back.





  66. Hello Captain,

    You wrote a post on Ramana(meditated in Tiruvanamalai) who is the last seer and attained moksha. I also went thru the post where you have written only Vishnu can grant moksha. Then, Ramana never worshipped Vishnu. How come Ramana attained moksha. Can Shiva grant moksha? How come Adi shankara attained moksha in kedarnath which is a SHIVA temple? Please clarify these doubts as i hope many would have the same doubts





  67. Hello Captain,

    Simply by raising kundalini via meditation, are we eligible for moksha? Is is not vishnu should be pleased by our deeds to give moksha for us?




  68. Hello Captain,

    I have one more question. Only by following advaitha, we can attain moksha or by following visistadvatha or dvaitha too can we attain moksha? By humble request captain, Please give answers.



  69. Sir,

  70. Sir
    One day I was reading Amar Chitra Katha(Gods & Goddess) book.While reading the book I came upon one strange god which I have never heard before.It was "Varuni"Goddess of wine.Is there any god like this in Hinduism? I know that other religions have different gods for everything for everything: Goddess Ishtar.Is Varuni some fake Rothschild's creation?



  71. yesterday i came across a Devdutt patnaik's show on epic so i just seen some unbearable minutes of it..still i got few questions upon his answers..plz explain( Devdutt was telling these below things)

    1. Airawat elephant was bought on earth by Arjuna by the path of Arrows.
    2. Pooram festival is elephant worshiping festival(plz give your views on this festival)
    3. Portuguese introduced over 300 plants to India. chili pepper, potatoes and tomatoes etc.
    4. coconut came to india through western Pacific.
    5. the soul who don't have a hungar is not soul at all

    1. hi dp,













      a lot of these FAKE and poisonous stories about Hindu heroes were cooked up by commie professors in JNU, in cahoots with white skinned foreigners .

      capt ajit vadakyil

    2. Very true Sir Very True...even i thought of that Portuguese thing..i think they fake injected it..they surely came with Bread and dry fish only...hehehe!

      Sir what about that Airawat- Arjun story?? and is that White Airawat of Indra existed??

  72. sir why multi headed snakes are shown in lord's images.(above d head)
    is there any reason or meaning for showing 2,3,4,5,6,7,9,11,.... headed snakes





  74. The Scriptwriter
    September 25, 2016 at 5:04 PM

    Dear Capt,
    Consider it done.
    For 800 years We Indians didn't have the right leaders. But we have now and his name is Capt Ajit Vadakayil. The young generation looks up to you and the wisdom you share!
    Jai Hind!

    Capt. Ajit Vadakayil
    September 25, 2016 at 8:21 PM
















    capt ajit vadakayil

  75. arvin singh
    October 31, 2016 at 4:26 PM

    Vatican issues guidelines on cremation, says no to scattering ashes


    Capt. Ajit Vadakayil
    October 31, 2016 at 4:53 PM







    capt ajit vadakayil















  77. Chrish Iangaar
    March 5, 2017 at 6:09 PM


    Capt. Ajit Vadakayil
    March 5, 2017 at 7:47 PM







    QUOTE: This blogsite will transform your mind . You yourself, are the teacher, the pupil, the messiah, the seeker, the traveller and the destination . It is no measure of health to be well adjusted to this profoundly sick society . I am from INDIA, the mother of all civilizations . I will be re-writing world history , and this will surely not gratify the evil hijackers of human history . Awaken your inner voice . Experience the joy of your own being . Your own conscience is the best interpreter . In a time of universal deceit, telling the truth is a revolutionary act . The naked truth can never be hate speech or defamation. This blogsite does not sacrifice truth on the altar of political correctness . You shall know the truth and the truth shall set you free . Dont ever underestimate the value of this blogsite .UNQUOTE

    capt ajit vadakayil











    capt ajit vadakayil
