Sunday, July 31, 2016

SANATANA DHARMA , HINDUISM EXHUMED AND RESURRECTED, PART 59 - CAPT AJIT VADAKAYIL


THIS POST IS CONTINUED FROM PART 58, BELOW--




NONE OF THE SO CALLED ANCIENT CIVILIZATIONS OF THE PLANET HAVE LEFT BEHIND ANYTHING OF CEREBRAL VALUE IN WRITING-- ABSOLUTELY  NOTHING !!     

80% OF OUR VEDAS ( SAMHITAS/ BRAHMANAS/ ARANYAKAS/ UPANSIHADS) HAVE BEEN STOLEN / DESTROYED BY THE WHITE INVADER.    

THE JEALOUS WHITE MAN  POST DATED OUR ANCIENT WORKS PENNED DOWN IN 5000 BC,   TO SUIT THEIR UNDERSTANDING OF BIG BANG DATED AT A RIDICULOUS 4004 BC.    

IN THIS INTERNET AGE, IT IS PAY BACK TIME !   


THE WORLD SHALL KNOW THE GLORY OF ANCIENT INDIA  !! 




CHECK OUT THE SOUND OF  PATANJALIs YOGA SUTRAS PENNED DOWN 7000 YEARS AGO, WHEN THE REST OF THE WORLD WERE RUNNING AROUND NAKED DOING GRUNT GRUNT




CHAPTER I-  SAMADHI PADA-   CONTEMPLATION
atha yoganushasanam
yogashchittavrittinirodhah
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pramannaviparyayavikalpanidrasmritayah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
vitarkavicharanandasmitaroopanugamatsanprajnatah
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tajjapastadarthabhavanam
tatah pratyakchetanadhigamopyantarayabhavashch
vyadhistyanasanshayapramadalasyaviratibhrantidarshanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah
duhkhadaurmanasyanggamejayatvashvasaprashvaavikshepasahabhuvah
tatpratishedhartham ekatattvabhyasah
maitreekarunamuditopekshanansukhaduhkhapunyapunyavishayananbhavanatashchittaprasadanam
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
ksheennavritterabhijatasyevmanergrahitrigrahannagrahyeshutatsthatadangjanatasamapattih
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih

CHAPTER II - SADHANA PADA-- PRACTISE

tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
anityashuchiduhkhanatmasunityashuchisukhatmakhyatiravidya
drigdarshanashaktyorekatmatevasmita
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
dhyanaheyastadvrittayah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
samadhisiddhirishvarapranidhanat
sthirasukham aasanam
prayatnashaithilyanantasamapattibhyam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah

CHAPTER III – VIBHOOTI PADA - MANIFESTATION

deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
sarvarthataikagratayoh
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
parinamatrayasanyamadatitanagatajnanam
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
sthoolasvaroopasookshmanvayarthavattvasamyamadbhootajayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti

CHAPTER IV--  KAIVALYA PADA --  LIBERATION

janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
nirmannachittanyasmitamatrat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
chiterapratisankramayastadakarapattausvabuddhisanvedanam
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah

purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti




2.49— tasmin sati shvasaprashvasayorgativichchhedah pranayamah


Expansion of the life force or vital energy by regulation of breath is next.



Pranayama is the regulation of the incoming and outgoing flow of breath with retention.  It needs to be practised only after perfection in asana has been attained.  Patanjali expressly advises the sadhaka to perform pranayama only after attaining perfection in asana.   For the first time, he demonstrates a distinct step in the ascension of the ladder of yoga, whereas he has not specified progression for the other aspects.  Normally the flow of breath is unrestrained and irregular. Observing these variations, and conditioning the mind to control the inflow, outflow and retention of the breath in a regular, rhythmic pattern, is pranayama.  The word pranayama consists of two components - prana and ayama.  Prana is energy, when the self-energising force encompasses the body.   Ayama means regulation.  Pranayama— where you exhale twice as long as inhale— is more about dumping old experiences rather than mere oxygenation  of blood.  It is always starts with the left nostril for right handers – for left handers it is vice versa ( no book on pranayama talks about this ) .. Left handed people have their sub-conscious in the left lobe of the brain.Breathe in the new , breathe out the old. Pranayama—inhale and exhale with awareness— long exhales with the sound of  MMMMMMM.    Humming boosts level of nitric oxide—this in turn ups the oxygen intake by 98%, the biggest secret . Ordinary breath is a mere 4%.  It is amazing Nitric oxide was discovered by Indian yogis 11000 years ago.  For re-inventing this a Nobel prize was given 2 decades ago.

Nitric oxide is necessary for-
1. Destruction of viruses, parasitic organisms, and malignant cells in the airways and lungs by inactivating their respiratory chain enzymes.
2. Regulation of binding - release of O2 to hemoglobin.
3. Vasodilation of arteries and arterioles (regulation of blood flow or perfusion of tissues).
4. Inhibitory effects of inflammation in blood vessels.
5. Hormonal effects. Nitric oxide influences secretion of hormones from several glands (adrenaline, pancreatic enzymes, and gonadotropin-releasing hormone)
6. Neurotransmission. Memory, sleeping, learning, feeling pain, and many other processes are possible only with NO present (for transmission of neuronal signals).

Obviously, during mouth breathing it is not possible to utilize one's own nitric oxide which is produced in the sinuses.  The mouth, was created by nature for eating, drinking, and speaking.  At all other times, your trap should be shut.When there is lack of oxygen in your blood , you living to a small percentage of your potential. Endurance exercise can increase oxygen utilization from 10 to 20 times over the resting state. This greatly also  increases the generation of free radicals, which can cause cancer.  Metabolism, or, more accurately the metabolic rate of the cells, sets the demand for oxygen. At rest, a human consumes about 250 millilitres of oxygen each minute. With exercise this rate can be increased more than 10-fold in a normal healthy individual, but a highly trained athlete may achieve a more than 20-fold increase.. Muscle can do more work, but beyond the aerobic scope they must revert to anaerobic metabolism, which results in waste products, mainly lactic acid.  The ability of the eye to dark-adapt (, increase its sensitivity at low light levels) decreases with age, but part of that decrease can be restored by breathing pure oxygen. Various mental processes in old people are also found to be improved by breathing oxygen. Any slowed induction of protein synthesis, as from lower oxygen intake, with age is a factor in the deficits of learning and memory of old people. 70% of toxins in your body are released by exhalation— rest by sweat, defecation and urine— surprised?  Oxygen drives the basic metabolic processes that permit growth and constant body temperature. The main purpose of respiration is to provide oxygen to the cells at a rate adequate to satisfy their metabolic needs. This involves transport of oxygen from the lung to the tissues by means of the circulation of blood. The precise object of respiration therefore is the supply of oxygen to the mitochondria.  Ganges' self-purifying quality leads to oxygen levels 25 times higher than any other river in the world. Ganga, show that it is able to reduce BOD (biochemical oxygen demand) levels much faster than in other rivers. Ganges cleans up suspended wastes twenty times faster than other rivers on the planet. The power of breathing lies in its relationship with your energy source. The mind is intimately connected to your breathing. Deep breathing triggers the lymph, your body’s sewage system which will give your cells more efficiency. It keeps the blood fully oxygenated. Breathe in the ration 1/4/2.  .The physical aspect of lack of oxygen in the body is not as important as the mental and spiritual aspect.  Lack of oxygen always slows your reaction time. The more oxygen our brains receive the better they function. Glial cells are mediators between the neurons and blood vessels of the brain. Oxygenating the brain can slow down constant die off of brain cells, and can activate areas of the brain which usually idle from lack of blood. The cells you use the least are the first to die off. 35000 brain cells die every day—more when there is lack of blood. But don’t worry, you have a stock of 100 billion brain cells. Arterial blood is slightly more acidic in pH value ( 0.05 ) than the venous blood. Blood is an electrolyte. Blood is a carrier for oxygen and nutrients to the cells, but more fundamentally it is a carrier of electrical current. The movement of blood produces EM waves through changes in the electrical charge (voltage) and current (amperage) of the fluid.  Because oxygen is vital to life, the body and brain are extremely sensitive to even very small reductions . This is why exercise must be done at least ONE hour after a meal or oxygen required for digestion is used by muscles leading to indigestion and cramps. Stress, fear and anxiety causes muscles to contract and blood vessels to constrict. When blood cannot be transported freely through the body to provide oxygen, and antibodies and to carry away and dispose toxic wastes, illness sets in. Mind is non material , but it works in partnership with communicator molecules. With every thought mind moves atoms of hydrogen, carbon , oxygen and other particles in the brain . Knowing the connection between breath and consciousness, the ancient yogis devised PRANAYAMA to stabilise energy and consciousness. All that vibrates in this universe is the cosmic personality and prime mover Prana, potent in all living beings and non-living beings --- heat, light, gravity, magnetism, vigor , power , vitality,life, spirit.   When a man is contented and happy , he has more Prana inside him. Anxiety vanishes entirely when you are one with the rest of the universe. When your mind is disturbed the fundamental energy Prana leaks . Pranayama just reverses the process.  Yoga says that longevity depends on slow deep diaphragmic breathing. A tortoise takes 4 breaths a minute and so lives more than 200 years. People who do Pranayama regularly have quieter nerves , less lethargy , better sleep and lower BP.  It prevents accumulation of Uric acid which gives joint pains. Fluctuations of mind are controlled and hence Pranayama prepares you for meditation.


The benefits are:--
1)  You raise your consciousness
2)  Develop inner peace
3)  Rekindle your drooping spirit
4)  Detoxification of body and mind
5)  Your face glows --balance of mind, body and spirit.
6)  Mental clarity and concentration
7)  Raise your immunity
8)  Reduces biological age.
9)  Centring yourself and stoking your inner flame
10)  Gratitude and communion with self
11)  Awakening at cellular level, improves metabolism, burns fat
12)  Expansion of perception
13)  Physical exercise , stretching, flexing of spine. Removes stiffness of joints and ligaments.
14) Destress.
15) Good sleep at night.
16) Miraculous delivery from disease -physical and mental.
17) Your skin is cleansed by sunlight and you have less BO. Clears eyesight too.
18) Improves body posture.
19) Drives away phobias.

The  HYPERVENTILATION ( Sudarshan Kriya ) patented by Triple Enyme Sri Ravsihankar made evil pharma very happy ,for it made people fall sick.   

VEDIC YOGA SUPPORTS ONLY DEEP DIAPHRAGMATIC BELLY BREATHING AND NEVER EVER SHALLOW CHEST HYPERVENTILATION, AS PATENTED BY SUDARSHAN KRIYA / SOHUM . .  

YOGA HAS SHUNNED HYPERVENTILATION , AND HAS USED BHASTRIKA PRANAYAMA ONLY TO SHIFT THE DOMINANT NOSTRIL ( IDA/ PINGALA ) FOR A FEW SECONDS. . . 

Human brain cells degenerate and die when you do hyperventilation. This is irreversible. . Hyperventilation leads to spontaneous and asynchronous firing of neurons . .. Brain diseases (or disorders of the central nervous system - CNS) are possible only in conditions of chronic hyperventilation, chest breathing and mouth breathing. . . Most brain diseases are characterized by chronic hyperventilation, there are additional effects due to low CO2 levels in the CNS. . .If excess ventilation cannot be compensated metabolically, it will lead to a rise in blood pH. This rise in blood pH is known as respiratory alkalosis. . .When hyperventilation leads to respiratory alkalosis, it causes dizziness, tingling in the lips, hands or feet, headache, weakness, fainting and seizures. . .In extreme cases it can cause carpopedal spasms (flapping and contraction of the hands and feet). . .Your body relies on carbonic acid to regulate the acidity of the entire bloodstream. By hyperventilating you remove far too much CO2 from your blood. . .The acidity of your bloodstream falls as a result. This has all sorts of nasty effects on your body if it is sustained, not least of which is an interference with nerve transmissions. . .Hypocalcemia, which results from hyperventilation, can cause tingling sensations, spasms of the muscles, and even convulsions. . Hyperventilating DOES store extra oxygen. But you can't necessarily use that extra oxygen, because with low CO2, your blood becomes too alkaline. . .Hemoglobin, in an alkaline environment, doesn't want to release the oxygen bound to it. . .Hyperventilation leads to MARTINI EFFECT and NIRTOGEN NARCOSIS.. Nitrogen narcosis is a neurological impairment caused by excess dissolved blood nitrogen . . Hyperventilation immediately causes a changed state of consciousness albeit a FAKE one . Many old people while doing hyperventilation on their beds have died . ..When a person hyperventilates, lowered level of carbon dioxide causes the pH of the blood to increase, leading to alkalosis. . .Yoga increases GABA levels in the brain . Low GABA levels are associated with depression and Alzheimer’s disease. . .Hyperventilation is NOT yoga.  Do NOT do too much kapabathi-- you will get inguinal hernia!Swara Yoga is the science which is about the realization of cosmic consciousness, through the awareness or observation, then control or manipulation of the flow of breath in the nostrils. Shiva answers Parvati's questions ( Vigyan Bhairava Tantra) patiently and fully and goes on the tell her all about swara saying that "for all beings, breath is only the base." These include techniques for managing the planetary effects and the moon's phases and avoiding the negative influence of the planets and astral forces, through altering the breath flow or swara in the nostrils, manipulating and controlling the breath or the breath flow through each nostril. While on the subject of effect of moon on women, some Chutney Marys attacked me –so some ancient secrets will not be revealed and are now lost forever. By swara yoga you can even choose the gender of the baby you want.  I guess signs tell us what happens for the best.



We can alter our destiny by  being more auspicious, and realising, and eventually attaining the harmony and the Highest Consciousness. Swara yoga is an ancient tantric science which involves the systematic study  of the breath flow through the nostrils (or swara) in relation to the prevailing phases of the moon, time of day and direction . Although we think of 'pranayama' when we think of techniques associated with the breath, in Swara yoga, it is the association of the breath in relation to the activities or phases or positions of the sun, moon, planets, seasons, time of day, with the physical and mental conditions of the individual and then taking the appropriate action according to these subtle relations. It was kept as a closed secret by the ancient sages and saints who had intuitively received this knowledge from the Divine. Swara yogi knows that during the flow of left nostril or right nostril when favorable elements rises certain things can be undertaken if you want to be successful. There are three modes of breathing- flow from left nostril, flow from right nostril and flow from both the nostrils. The last mode is generally for a short duration when breathing switches from left to right and vice versa.  Mode of breathing can be checked by examining air flow while exhaling. All our actions can be classified into three main categories; physical, mental and spiritual; which are respectively presided by the above three modes of breathing.  Breathing through the left nostril ( ida nadi ) stimulates the right hemisphere of brain, and breathing through the right nostril ( pingala nadi ) stimulates the left hemisphere. Breathing through the left nostril is connected with higher intraocular pressure and breathing through the right nostril lowers that pressure Intraocular pressure  is created by the continual renewal of fluids within the eye. The intraocular pressure is increased in glaucoma. Breathing through the left nostril stimulates Ida which relates to the moon and the parasympathetic nervous system, breathing through the right stimulates Pingala, relating to the sun and sympathetic nervous system.   Ida nadi is associated with the rest and restorative system of the body, whereas the pingala nadi is associated with the fight and flight response. Pranayama starts with the left nostril always. The benefits of left nostril breathing are numerous including sharper, clearer focus of the mind, and a deep, full relaxation or sleep.  In the Yogic tradition, left nostril breathing has been used to break vices and habits, which usually take 21 days  . If you watch your breath you will find that it is usually flowing more in one nostril than the other. Again, if the left nostril has a greater flow of air, then ida nadi is predominant. When the flow is greater in the right nostril, then pingala is predominant. If the flow is equal, then sushumna is ruling. When the right nostril is flowing, then vital energy is more active, allowing the individual to do physical work, digest food and so on. The mind is extroverted and the body generates more heat. When the left nostril (ida) is flowing, mental energy is dominant, the mind is introverted, any kind of mental work; thinking concentration, etc., may be undertaken. Ida nadi also flows mainly during sleep. The primary aim of hatha yoga is to bring about a balance of flow between the prana in ida and pingala, (ha = sun, tha = moon). To do this the body is purified by the six techniques known as the shatkarmas.  As per swara yoga, in a day the flow of air through the left nostril should predominate for about twelve hours and through the right nostril for the other twelve hours. If pingala flows, the body will be restless; if ida flows, the mind will tend to think too much. In human physiology, the two nadis correspond roughly to the two halves of the autonomic nervous system - the sympathetic and parasympathetic. Pingala coincides with the sympathetic nerves, responsible for the stimulation and acceleration of activities concerned with the external environment and the deceleration of the organs which tend to utilize a lot of energy internally. The sympathetic nerves speed up the heart, dilate the blood vessels, increase the respiration rate, and intensify the efficiency of the eyes, ears, etc. The parasympathetic nerves directly oppose the sympathetic nerves, for they reduce the heartbeat, constrict the blood vessels, and slow the respiration so that the individual becomes introverted. The flow of prana in ida and pingala is completely involuntary and unconscious until yogic practices control it. A Swara yogi realizes cosmic consciousness through control and manipulation of breath. The ancient 7000 year old Sanskrit texts mention 72,000 subtle channels through which prana flows, the dominant flow of prana occurs within the ida and pingala nadis, two channels that course upwards on either side of the spine from their origin within the kanda or ‘bulb’ in the sacral plexus. The ida and pingala nadis relate to the activities of the parasympathetic and sympathetic divisions of the autonomic nervous system, respectively. Surya Bhedana when breathing in through the right nostril and Chandra bhedana when breathing in through the left nostril. Breathing in takes air down to the lungs which will produce suction in the eustachian tube. Scientists have postulated that external forces set the biological clock by stimulating the pineal gland, which is affected by dark/light cycles.  These rhythms which were previously known to the ancient Rishis, so man is actually only rediscovering himself in relation to the cosmos. By the practice of Swara yoga one  can become the master of the nadis and elements, so as to adjust himself with  the universal forces which is the source of everything that gives birth to the experience of both  material and spiritual life with heightened awareness.  As per Swara Yoga , different modes of breathing leads to different types of actions; physical, mental and spiritual.   Swarodaya Yoga’ has three types of breathing systems – For a right hander  Ida (Inhaling and exhaling from  left nostril ), Pingala (inhaling and exhaling from right side of the nostril) and Sushmana (inhaling and exhaling from both sides of the nostrils). We mostly breathe in and out from either Ida or Pingla but sometimes we breathe from both the nostrils.  The Sushumna mode is generally for a short duration when breathing switches from left to right and vice versa.  Mode of breathing can be checked by examining air flow while exhaling. Compliance to the dictums of ‘Swar Shaastras’ is more efficacious than omens, and a suitable time selected through astrology based on moon and planet phases. it was used to go beyond the limitations of the mind.
One must change mode of breathing suitably at the time of initiating specific desired activity. Example: When the left nostril is running (for righthanders ) , intitiation of mantras and consecration of deities in temples is done. When the right nostril is running certain deadly and destructive vashikaran mantras of Atharva Veda and psychic works are done.  I will only say so much. Swara yoga aims at directly awakening the highest human potential. . Swara Yoga is a path which leads to awakening of the entire being.




2.50---bahyabhyantarastambhavrittih deshakalasankhyabhih paridrishto dirghasookshmah


Pranayama has through movements prolonged and fine inhalation, exhalation and retention; all regulated with precision according to duration and place.



The first three components of pranayama are regulated inhalation, exhalation and retention; all must be performed, prolonged and refined according to the capacity of the aspirant. The components are to be observed with regard to place (deia), here meaning the torso, kala indicating length of breath and samkhya, denoting precision. There are two types of retention in pranayama. They comprise the interruption of the breath flow following either the in- or outbreath. The movements of the breath and the pauses between them are modulated and prolonged according to the capacity of the lungs (deia), the duration and measured regulation of the breath (kala) and the degree of refinement and subtlety (samkya) of the sadhaka. Mastery is attained by practising in synchronisation, with rhythmic regulation (paridrsfa). Concentration on the regulation of breath (prana vrtti), exhalation (bahya vrtti), inhalation (antara vrtti) and retention (stambha vrtti) is called sabtja (seed) pranayama, because attention is on the breath itself. Inhalation moves from the core of being - the seer - towards the consciousness. As mahat or cosmic intelligence is the first principle for nature's activity, its individual counterpart - citta, acts to excite the soul to activity. The inbreath is made to touch the five sheaths of the body - anandamaya, vijnanamaya, manomaya, pranamaya and annamaya, or the elements - akasa, vayu, tej, ap and prthvi; while the out breath touches in the reverse order. Bracing of the inbreath is the evolution of the soul or the ascending order of the purusa. When the self comes in contact with the physical body, inhalation is complete. Here, the purusa encompasses prakrti. The outbreath moves from the external body towards the seer, layer after layer. It is involution, or the descending order of prakrti to meet its Lord, purusa. If the inbreath is the divine union of purusa with prakrti, the out breath is the union of prakrti with purusa. Retention of the former is antara kumbhaka, retention of the latter is bahya kumbhaka. If antara kumbhaka establishes dedication of the seer (svarupa pratistha), bahya kumbhaka releases one from the four aims of life (purusartha sitnya). Kumbhaka is the pause between an inhale and exhale. Retention or holding the breath, is a state where there is no inhalation or exalation.   The khumbhaka which follows the inhale is called the bahya kumbhaka and that which follows the exhale is called the antara kumbhaka. (Bahya means outer/exterior. Antara means inner/interior).  Antar Kumbhaka,is ceasing of breath when the inhalation (or Poorak) is complete and the lungs are filled up with air. In this kumbhaka, inhalation is recommended to be slightly forceful to take more air than normal and ceasing it as per one's ability.  Bahya Kumbhaka, is ceasing of breath when the exhalation (or Rechak) is complete. It is also recommended to exhale more than normal and then cease it as per one's ability.  Sahit Kumbhaka, is the kumbhaka performed with inhalation or exhalation.  In Kevali Kumbhaka,inhalation or exhalation is not required or not focussed in exercising Kevali Kumbhaka. It is the extreme stage of Kumbhaka which is attained only by continuous long term pranayama and kumbhak exercises.  Respiration includes inhalation and exhalation. In between these two processes there is a very minute gap or pause (normally in milliseconds) which is usually not noticed and it recurs, i.e., inhalation-pause-exhalation-pause-inhalation.... and it continues. The maximum gap or pause is observed in the state of rest. Kumbhak enforces to increase the pause by ceasing the breath routinely and continuously by various types of pranayama and kumbhaka exercises.  It has been said that It is being observed that the more time spent for pranayama (and kumbhaka); the more is the concentration and the better is the control over mind. Various ancient yogis (expert in yoga and pranayama) noticed the importance of respiration and its correlation with activities of mind and vital forces. Aging is also seen proportional to frequency of respiration or respiratory rate, i.e., frequency of inhalation and exhalation in one minute. Medical science recorded normal respiratory rate in humans as 12-16 breaths per minute with life span of 70–80 years. Practicing kumbhaka for a long time increases endurance of physiological as well as psychological structure of an individual. Continuous and long term practicing increases the hold or control on breath up to an extent where it reaches to its extreme stage (Kevali Kumbhak) and the respiration is ceased permanently unless desired to get into normal state. Aging is proportional to metabolism which in turn is proportional to respiratory rate. Metabolism lowers down as the respiratory rate decreases and this helps prevent aging or at least lowers down the process. It has not been recorded scientifically whether kevali kumbhaka can increase age (or can make immortality a fact) by lowering down the basic reactions which support life, however, various yoga sutras and religious scriptures define samadhi and immortality an approachable aspiration for determined individuals. The pranayama technique intends to shorten the period of these inhalation and exhalation processes in order that the force with which this process goes on, or continues, is brought to the minimum so that there is no strength in this flow, though the flow is tending to go outward and inward as it has been doing ever since the birth of the individual. How long does the breath remain outside in exhalation? How long does it remain inward in inhalation? These are the things to be observed.  We have to infer the movement of the prana when we inhale merely by feeling its movement within. If we are cautious and contemplative, we can feel how the prana moves when we deeply breathe in. The purpose is to stop this lengthening of the breath, outwardly as well as inwardly – to shorten it as far as possible, until it becomes so short that there is practically no movement at all. That cessation of movement is called kumbhaka. This cessation of the breath can be brought about in many ways. Though the yoga shastras speak of several types of pranayama or kumbhaka, Patanjali concerns himself with only four types – which are actually not four, really speaking. They are only one, mentioned in four different ways. Bāhya ābhyantara stambha vṛttiḥ (II.50) are the terms used in the sutra. Bahya is external; abhyantara is internal; stambha is sudden retention; vritti is the process. The external retention is what is known as bahya vritti,the internal retention is what is known as abhyantara vritti, and the sudden retentionis what is known as stambha vritti. These vrittis, or the processes of the movement of the prana, are measured across different parameters, as enumerated through the other terms in the sutra, deśa kāla saṁkhyābhiḥ (II.50), for calculating the retention of the breath. The prana can be stopped by way of retention after exhalation. This was referred to in an earlier sutra where a particular method of breathing was prescribed as a way of bringing about peace of mind when the mind is very much disturbed. That sutra is in the Samadhi Pada: pracchardana vidhāraṇābhyāṁ vā prāṇasya (I.34). Pracchardana is expulsion; vidharana is retention. The expulsion and the retention of the breath are supposed to be one of the means of bringing about composure of mind.  This is almost the same as one of the pranayamas mentioned here as bahya vritti. We breathe out, gradually and intensely, in a very spontaneous, flowing manner, and then do not breathe in; this is one pranayama. We can press the abdomen inward and then raise up the diaphragm. After the inhalation, generally the chest is forward at this time. The breath is then blown out – not suddenly with a jerk, which should not be done – but very calmly so that we will not even know that it is blowing out. Then, we do not breathe in immediately; we see how far we can maintain this position of expulsion without it being followed by inward breathing. This sort of retention of the breath, which means to say the cessation of breathing in after the breathing out, is called bahya vritti – the pranayama, or the kumbhaka, which follows expulsion. Or there can be abhyantara vritti, which is retention of the breath after inhalation. We breathe in, in the same way as we exhale – calmly, forcefully, deeply – and then do not breathe out. That retention of the breath after deep inhalation is a pranayama by itself. The way in which we retain the breath is called kumbhaka. Kumbha means a kind of pot which can be filled with things. We fill our system with the whole prana in pranayama. Though the prana is moving everywhere in the system even at other times than during the time of kumbhaka, something very peculiar takes place during kumbhaka which does not happen at other times. During kumbhaka the prana in the system is filled to the brim, and it remains unmoving and unshaken, just as a pot may be filled to the brim and the content or liquid inside does not shake due to its being filled up to the brim, to the utmost possible extent. There is no movement of the prana in kumbhaka; it is not trying to escape from one place to another place. The escaping of the prana from one place to another place actually means the difference which it introduces in the density of its activity, which is the cause of unequal distribution of energy in the system. Because there is no equal distribution of force in the body, there is difficulty – physiological as well as psychological. The senses, especially, become very active and uncontrollable on account of the unequal distribution of energy, or prana, in the system and a capitalist attitude of the prana towards the senses only, where it is stored up in an excessive measure, depriving the other parts of the required energy. When a particular sense organ is very active, there is an excessive measure of prana supply given to that particular location of the organ which intends to fulfil itself. There is the irritation of the senses or an itching of the particular organ due to the excessive flow of the prana there. It may be the eye, the ear, or any organ. We have ten organs, and one of the organs will start itching. This itching, or irritation, or craving of a particular organ is due to an abundant supply of prana in that particular part of the body, which implies a deprivation of other parts of the body from the requisite energy. The kumbhaka process is a technique by which this excessive emphasis which prana lays on any particular part of the body is obviated, and it is allowed to equally distribute itself in the whole system, which is another way of saying that the rajas of the prana is made to cease. The excessive emphasis of the prana in any particular part of the system is due to rajas, which means there is movement. Without movement, how can there be any kind of unequal distribution of energy? This is prevented by the process of kumbhaka. The filling of the system with the pranic energy means distributing the energy equally in the whole system and making it felt everywhere equally, with equal intensity, and without the special favour it sometimes does to a particular limb or organ. This is what happens in kumbhaka. It can be done, as mentioned, either after exhalation or after inhalation. Either we breathe out and retain the breath, or we breathe in and retain it. These are the two types of kumbhaka mentioned as bahya vritti and abhyantara vritti. There is a third type called stambha vritti, which is not followed either by inhalation or exhalation. Any kind of sudden stopping of the breath is called stambha vritti. When we are deeply absorbed in a particular thought, very deeply absorbed, and we are not able to think anything other than that one particular thought due to intense affection or intense hatred, or for any reason whatsoever, the prana stops; there will be no breathing at that time. When we are overpowered with the emotion of love, or fear, or hatred, there will be a stoppage of prana. Thus, raga, bahya and krodha are the causes of the prana suddenly stopping – intense raga, intense bahya and intense krodha. Here we are not concerned with bahya or krodha, or with raga of the ordinary type; but if we want to call it raga, we may call it so. It is a great love for the great ideal of yoga; the ardour that is expected in every student of yoga. The yearning that he cherishes within, the longing that is uncontrollable for God-realisation may be regarded as a kind of superior raga that is present, which prevents the mind from thinking anything else. When the prana is suddenly withheld – not accompanied either by expulsion or inhalation – that type of retention which is suddenly introduced, for any reason whatsoever, is called stambha vritti. They are the three types of kumbhaka mentioned in the sutra, bāhya ābhyantara stambha vṛttiḥ.  Now Patanjali mentions deśa kāla saṁkhyābhiḥ paridṛṣṭaḥ (II.50). The measure or the calculation of the method of breathing for the purpose of retention is referred to here. We can find out to what extent we have mastered the technique of pranayama by the extent of the length of space occupied by the movement of the prana, externally or internally.  A cotton fibre held near the nostrils will give us an idea of the space that is occupied by the prana in expulsion. When we have greater and greater mastery over the prana, the distance will be lessened gradually so that we may have to bring the cotton fibre nearer and nearer the nose to see its movement. So also is the case with internal movement, or inhalation. This has to be practised very, very gradually. What the sutra tells us is that kumbhaka, or retention of the breath, should be acquired by a gradual diminishing of the distance covered by the movement of the prana in expulsion as well as inhalation; that is desa. Kala means the time, the ratio, or the proportion that is maintained in the processes of inhalation, retention and expulsion. There are various views or opinions expressed by the yoga shastras and by adepts in yoga in regard to this proportion. Proportion means the time that we take to inhale, the time that we retain the breath for, and the time that we take to exhale. This is what is called proportion – that is the ratio.   There should be no retention at all in the earlier stages; there should be only deep inhalation and exhalation. For some days and months perhaps, we may have to practise only inhalation and exhalation without retention. Later on, when retention is introduced, it should not be in this ratio of one to four to two, as it is a more advanced practice. There should be only a comfortable retention, to the extent possible, even if the ratio is not maintained. By the measurements of the processes of breathing, in respect of place, time and number, the quality of the pranayama should be determined. It is either dirgha or it is sukshma; it is elongated, protracted, or it is short and subtle. It may be a protracted breathing, or it may be a very subtle breathing, which means to say that it can be elongated in quantity and intensified in quality; that is the meaning of dirgha. Or it can be contracted, and reduced in quantity as well as in quality; that is sukshma. When this is acquired, this mastery is gained, some sort of a control is maintained over the pranic movements. Great consequences – unexpected and unforeseen – will follow. We will see strange phenomena appear within us as well as outside us if we gain mastery over the prana, because this kumbhaka that we are speaking of is nothing but another form of concentration of mind, as the mind is associated with the prana always. The object, or the ideal before oneself, is united with the meditating consciousness in a fast embrace, as it were, when the prana is withheld, and it is made to stick to one’s consciousness inseparably. It becomes one with one’s own self, and there is a sudden impact felt upon the object on account of the kumbhaka that we practise. The kumbhaka, the retention of the breath that we practise, coupled with concentration of mind on the object that is before us, will tell upon the nature of that object which we are thinking of, whatever be the distance of that object. It may be millions of miles away – it makes no difference. This is because prana is omnipresent. It is like ether, and so it will produce an impact upon the object that we are thinking of in our meditation. It will stir it up into an activity of a desired manner, according to what we are contemplating in the mind. This effect cannot be produced if the prana is allowed to move hither and thither, distractedly. If we want quick success in meditation, the retention of the breath is absolutely necessary because it is this that impresses upon the object of meditation the necessity to commingle itself with the subject. Therefore, a combination of pranayama and dharana, concentration, is the most effective method of bringing about a union of oneself with the ideal of meditation.




2.51--- bahyabhyantaravishayakshepi chaturthah

The fourth type of pranayama surpasses the external and internal pranayamas, and appears effortless and non-deliberate.


The fourth type of pranayama goes beyond the regulation or modulation of breath flow and retention, surpassing the methodology stated in the previous sutra.  When the movement of the breath functions without one's will or effort, the fourth stage of pranayama has been accomplished. The movements of the mind ( monkey chatter ) and consciousness ceases. The flow of essential energy, intelligence and consciousness comes to a standstill except for subliminal impressions.  A state of suspension is experienced, in both the breath and the mind. From this springs forth a new awakening and the light of intelligence forcefully imbues the sadhaka's innermost being. The process of respiration has three components.  Pooraka is inspiration of air, kumbhaka means retention, and rechaka is expiration.  It can be said that kumbhaka is pranayama and pranayama is kumbhaka, not pooraka and rechaka, which are natural processes.  Kumbhaka is again of three types. Bahir kumbhaka is retention of breath at the end of expiration. Antar kumbhaka means holding the breath after inspiration of air, and kevala kumbhaka or sahaja kumbhaka implies holding the breath with no particular state of respiration in consideration. Kevala kumbhaka is one of the final stages of yoga parallel with the state of samadhi.  Bahir kumbhaka is not used very often.Kumbhaka is of two kinds, viz., Sahita and Kevala. That which is coupled with inhalation and exhalation is termed Sahita. That which is devoid of these is called Kevala (alone). When you get mastery in Sahita, then you can attempt for this Kevala. When in due course of practice, the Kumbhaka subsists in many places without exhalation and inhalation, unconditioned by place, time and number -then that Kumbhaka is called absolute and pure (Kevala Kumbhaka), the fourth form of 'Regulation of breath'.  In Vasishtha Samhita it is said: "When after giving up inhalation and exhalation, one holds his breath with ease, it is absolute Kumbhaka (Kevala)." In this Pranayama the breath is suddenly stopped without Puraka and Rechaka. The student can retain his breath as long as he likes through this Kumbhaka. He attains the state of Raja Yoga. Through Kevala Kumbhaka, the knowledge of Kundalini arises. Kundalini is aroused and the Sushumna is free from all sorts of obstacles. He attains perfection in Hatha Yoga. You can practise this Kumbhaka three times a day. He who knows Pranayama and Kevala is the real Yogi. This Kumbhaka cures diseases and promotes longevity. 
The physicochemical process of diffusion is dependent mostly on the extent of surface area available for the process to take place, the condition of the membrane in between, and the pressure of gases on either side of the membrane. The process of diffusion, especially of gases as occurs in respiration, is not so much dependent on the time factor. Once the pressure of gases is equalised on either side of the membrane, diffusion comes to a standstill. Hence, withholding the breath for a longer time does not afford any advantage as far as the exchange of gases is concerned. What then could be the advantages derived from kumbhaka? The rate of the heart is slowed in inspiration. With a slower rate, the resting period of the heart- the diastole- is prolonged. Not only does the heart muscle receive more rest, but the cavities of the heart are also better filled with blood. During the next pumping action of contraction (systole), more blood is pushed into circulation with a better force. Thus general circulation is improved. During kumbhaka no new air is entering the lungs, so no more oxygenation is taking place. The oxygen tension in the blood is reduced. Up to a certain level this has an advantage. The brain is most sensitive to this lowered oxygen tension, as its needs for oxygen are the greatest. If the quality of the blood is below par, the brain tries to get more blood in quantity. In the brain and even elsewhere in the body, all the capillaries are not functioning at all times. Some of them are lying dormant in a collapsed or closed state. In order to receive a greater quantity of blood, these capillaries are opened up. The effect is more marked in the brain. Thus cerebral anoxia leads to cerebral vasodilation, more capillaries open up and circulation improves. It must be emphasised that this effect is beneficial up to a certain optimum level only. Beyond this level it is distinctly harmful. Hence, it is always stressed that the practice of kumbhaka must be undertaken with the guidance of an experienced teacher. The practice of pranayama has fallen into disrepute in the eyes of the public, mainly because of the malpractice of breath retention. This explanation of cerebral anoxia, causing cerebral vasodilation, applies equally well to the practice of bahir kumbhaka.  The third phase of respiration is expiration. Expiration is a passive act. For stretching a rubber band one needs a conscious effort, while once the active action is released the rubber automatically assumes its original position. The same principle applies to the act of respiration. But the yogic act of rechaka is a slow, guided and controlled process. It should take double the time taken for inspiration. The first advantage of slow respiration is mechanical. With a sudden release the rubber or the elastic tissue in the lungs will snap back violently, but with a slow release it will maintain its elasticity. The major advantage of slow rechaka, however, is in the brain and psyche. The conscious effort required for slow release needs the help of the cerebral cortex of the brain. The cerebral cortex sends inhibitory impulses to the respiratory centre in the midbrain. These inhibitory impulses from the cortex overflow into the adjoining area of the hypothalamus concerned with emotions, and quieten this area. Hence, the soothing effect of a slow expiration.  It also helps the next stage of ashtanga yoga i.e. pratyahara. Pratyahara means drawing in of the senses and the thought processes. The human mind is like a child. If it is asked not to do a certain thing, it will deliberately try to do it. Hence it is better to give a positive suggestion to a child as well as to the human mind. Instead of asking it to stop thinking, it is given the positive suggestion of observing the respiration. Thus the senses and the thought processes are automatically switched off.  Throughout our life, we are breathing continuously, and involuntarily, day in and day out, during waking and sleeping states. The very first instruction in the teaching of pranayama is to observe this breathing process as it is going on naturally, without trying to modify it. Even this simple act has a physiological implication. Automatic respiration is controlled by the respiratory centre, situated in the midbrain. But once we become aware of the process of respiration, its control shifts to the cerebral cortex. This involvement of the cerebral cortex causes the cortex to develop. Further development of the cerebral cortex leads to a higher stage of the evolutionary cycle.In Kevala kumbhaka, (only/isolated breath retention), the breath is retained or held and is often practiced in pranayama along with the bandhas and meditation. This form of breath retention concentrates on holding the breath on a subtle breath, not on or directly after an explicit inhalation or exhalation. Kevala kumbhaka influences prana being held within the body, increasing vitality and positive energy within the self, and is an important practice in Hatha yoga.   Kevala kumbhaka does not require inhalation or exhalation and is considered the final stage of spiritual union, or samadhi. Kevala kumbhaka is not simply holding the breath between an inhale or an exhale. It is considered holding the prana completely separate of the movements of inhales or exhales, and is an unprompted stop of breath that occurs within a samadhi state attained through pranayama. Many diseases are caused by disturbances within the pranic energy system in the body and mind. Pranayama – for example, nadi shodhana (alternate nostril breathing) with antar kumbhaka – helps bring the energy system into harmony. Therefore, effective practice of a kumbhaka (like kevala kumbhaka) in conjunction with pranayama helps prevent and treat a wide variety of diseases.When the full length of the wind is all confined in the body, nothing being allowed to go out, it is Kevala Kumbhaka. There are no regular Rechaka and Puraka in this process. It is only (Kevala) Kumbhaka.  Kevala Kumbhaka  helps increase breath control and lung capacity.A pause may be very short, even only a fraction of a second (eg., quick puffs) or it may be very long. As an illustration, try holding your lungs full of air and see how long you can do so. You will find that you can retain it for several seconds and even, perhaps, for minutes. If you happen to be fatigued and if your body needs constant replenishment of oxygen, you may be unable to hold your breath very long. But when you have become rested and relaxed and when your body is already well supplied with oxygen, you may hold your breath much longer. Practitioners of yoga extend the duration of a full pause by first breathing regularly for some time until the body becomes oversupplied with oxygen and then taking an extended pause without discomfort. When you try this, please remember to quit the practice when you fell the discomfort. Advanced practitioners of yoga are said to be able to stop breathing for an hour or more without discomfort. Some of them eventually can remain almost completely motionless for days, even having themselves buried for such periods in order to demonstrate ability to survive without food, water or very much air. When buried, they do not stop breathing entirely, but their inhalations and exhalations become so long and slow and their pauses so prolonged that almost no energy is consumed and very little oxygen is needed. Even their heartbeats become so retarded that only a minimum of oxygen is needed by the heart muscles. Their cerebral activity almost ceases, so very little energy is needed to support the voracious capacity of the nervous system.  This is a semi-hibernation technique by yogis. Yogis can be trapped under avalanche snow and come out alive after several days. There are some significant ways of attaining relatively complete relaxation by use of these pauses between breathing. One cannot retain his breathing for an extended duration as long as he is nervous, anxious or fatigued. So, in pursuit of extended pauses, he will have to do what is required to attain a state of rest. When you have attained full state of rest, it will result in the reduction or elimination of nervousness. It is an extremely powerful technique to incite relaxation response. There are some traditional Yogic techniques  to prolong the pauses. These involve deliberate attempts to block breathing passages in such a way that air does not escape of its own accord when chest and abdominal muscles become relaxed. These aids are called bandha. Bandha is a Sanskrit word related to English word "bind".   Each of the bandha employed for prolonging breathing pauses binds air in our lungs or closes and locks the air channels so that no air can escape or enter. We will look at four important bandhas. The parts of the body mainly involved are the (a) lips and palate, (b) glottis, (c) chin and (d) diaphragm. The first two seem more important in prolonging full pauses and the last two more necessary for retaining empty pauses.AA. Bandha involving Lips and Palate:- This is a technique used by swimmers. Closing our lips tightly so no air can escape through the mouth. Pressing lips against the teeth may aid in tightening them. If your nostrils are clear, simply lift your soft palate against the roof of your pharynx and close the passage into the nostrils. This may be done deliberately or you may learn to allow this to happen automatically after some training. A little air pressure from your lungs may aid in holding the palate in such a closed position BB-. Bandha involving Glottis:-You can prevent air from leaving your lungs by closing your glottis. Your glottis closes automatically when you swallow. All you need to do is to stop your swallowing movements at that point where your trachea is closed. This may be difficult to do at first, since an automatic reflex pattern has been built into your autonomic nervous mechanisms. But a little effort at trying to attain voluntary control over your involuntary processes should give you mastery of this technique. Of course, you may combine both the lips and the palate closure with the glottis closure to produce a still tighter lock. CC- Jalandhara Bandha (Bandha involving Chin):- 
The jalandhara bandha or "chin lock" consists in pressing the chin close to the chest and dropping the head to help in maintaining immobility of muscle and air movements. This position is very useful in holding an empty pause, for the pressure of the chin against the chest pushes the base of the tongue and the larynx up into the pharynx and against the palate, thus providing aid in resisting the pressure caused by the vacuum in the lungs. DD- Uddiyana Bandha (Bandha Involving Diaphragm)- A fourth bandha, uddiyana bandha, involves raising the diaphragm and keeping it immobile during an empty pause. The abdomen must be drawn in and up as far as possible. Expel all air before using this bandha. In order to attain complete control and more comfort, one may put forth some effort in one or more mock inhalations, without admitting any air, before assuming fullest relaxation possible during this pause. You may combine both chin lock and raised diaphragm techniques in retaining an empty pause. Both of these techniques can be employed in either a standing or sitting position and they are commonly employed together during sitting postures. These two bandhas appear to serve as strenuous and circulation-stimulating exercises rather than muscle- and will quieting attitudes, though they do aid a person in attaining thorough mastery over his respiration cycle.
The problem of prolonging the duration of a pause should be approached with caution, patience and practice. Gradually lengthen the duration of a pause by counting. Use your fingers to count the duration of a pause. After each successive pause, add one unit of pause to the rest. If you try to attain a prolonged pause on the first attempt, you are very likely to overdo it, suffer some discomfort and feel no beneficial or restful effects. Whenever a series of increasingly extended pauses reaches the point where you feel the need to exert effort in order to hold the pause longer, stop immediately. By repeating such a series once a day for several days-or even several times a day for several days-you can observe a gradual increase in the length of the pauses which may be held with comfort. The progress you make is mainly an individual matter. Some persons can do this much easier than others.Kevala kumbhaka (perfectly peaceful pause) involves not only complete cessation of movement of air and muscles but also of all awareness of such movement and tendencies. The state experienced is one of complete rest. Urgency, interest, motive, will, desire, etc. all disappear momentarily along with the disappearance of specific interests and anxieties, such as those of hatred, fear, ambition, love, hunger and thirst. You will also feel detached from tendencies such as to hate specific tasks, to fear particular persons, to demand specific rights or to zealously force oneself or others to attain indicated goals. During such a peaceful pause, quiescence is experienced as perfect. For anyone writhing under the pressures of multiple anxieties, the experience of the utter peacefulness of kevala kumbhaka even for a moment, provides a very restful and blissful moment.  The experiences of kevala kumbhaka helps in retarding progressive over-anxiety that is common in our society. Suicides and suicidal tendencies, which result from the development of unbearable anxieties, may be retarded and prevented by sufficiently assiduous practice of yoga. The automatic mechanisms which spontaneously induce inhaling and exhaling, as well as heartbeats and hunger and thirst, can be modified and inhibited for short periods.Pranayama is of three kinds according to the strength and capacity of the practitioner. The best one is that wherein Puraka is for 20 seconds (Matra is the Sanskrit word for second. 1 Matra is equal to 1 second.), Kumbhaka for 80 seconds and Rechaka for 40 seconds. The middling one is that wherein Puraka is for 16 seconds, Kumbhaka for 64 seconds and Rechaka for 32 seconds. The lowest one is that wherein Puraka is for 12 seconds, Kumbhaka for 48 seconds and Rechaka for 24 seconds. You should inhale and exhale very, very slowly, without producing any sound all the while. The ratio between Puraka, Kumbhaka and Rechaka is 1:4:2.. To perform Pranayama, as you inhale, first push out your abdomen, then expand your chest and as you exhale, first pull in your abdomen to help empty the base of your lungs, then allow your chest to collapse.  This is known as diaphragmatic breathing, because as you inhale your diaphragm contracts and pushes down into the abdomen. Pushing your abdominal wall out makes room for this to happen. During exhalation, "pulling in" your abdominal wall facilitates the diaphragm rising up. With diaphragmatic breathing the amount of air entering your lungs increases significantly. This allows more oxygen to enter your bloodstream. Shallow chest breathing allows approximately 350 ml of air to enter the lungs, compared to the 4500ml that can enter the lungs when you breathe diaphragmatically. Training yourself to consistently breathe deeply while using your diaphragm will ensure that more air enters your lungs. Another breathing technique is a type of relaxing sigh. This is deep diaphragmatic breathing . Sit in a chair and let out a long sigh of relief, then let air into your lungs naturally. Repeat eight to twelve times.Breathing is a unique physiological function as it is both voluntary and automatic. By modifying one’s breathing, taking slower, deeper breaths one has the ability to help control the nervous system. Ultimately, breathing slowly can induce a state of relaxation, focus, and calmness.When we breathe only using the chest, our breathing becomes rapid and shallow. This kind of chest breathing doesn’t fully expand the lungs and leaves static air in parts of the lungs. Expanding only parts of the lungs increases the likelihood of poor blood circulation, which impairs the functioning of the organs and can lead to infection or other health problems. Deep breathing stimulates and allows your lymph system to work better and thus, avoid circulatory problems. Pumped from the heart, blood circulates oxygen to the arteries and capillaries. Cells in our bodies take oxygen for their health and excrete toxins. Cells depend on the lymphatic as the only way to expel toxins.How you breathe directly affects your cardiovascular system. Daily practice of deep, diaphragmatic breathing on a daily basis has been shown to have a positive effect on essential hypertension (high blood pressure of unknown cause). Other problems such as headaches and migraines, which can be caused by a lack of oxygen, will also benefit from deep breathing. Although breathing from your diaphragm is easy to do, the habit of doing it must be consciously cultivated before it can become automatic.



Sir,
such a beautiful rendering and description of Brahman within... I thought of providing the link so that it will be helpful for the subsribers..

https://www.youtube.com/watch?v=42RE6mlT6tI




  1. hi mc,

    WHEN YOU DIE

    YOU ARE NOT DEAD, IN REALITY

    YOU HAVE JUST DISCARDED YOUR OLD PHYSICAL BODY

    LIKE HOW YOUR REMOVED YOUR DIRTY JEANS FOR LAUNDRY

    YOUR SOUL WAS BORN WITH THE STARS

    YOUR SOUL WAS ONCE PART OF THE FIELD OF BRAHMAN

    YOUR SOUL WILL SOON MERGE BACK WITH THE MOTHER FIELD

    YOU ( SOUL ) ON GETTING MOKSHA , WILL DOWNLOAD ALL PAST EXPERIENCES THROUGH EVERY FORM OF LIFE ON PLANET EARTH INTO THE MOTHER FIELD-- LIKE HOW A PEN DRIVE DOWNLOADS INFO INTO THE HARD DRIVE OF THE COMPUTER

    WHAT IS THERE TO CRY ABOUT?

    YOUR GREAT GRANDFATHER , YOUR UNBORN GREAT GRANDSON WERE ALL BORN AT THE SAME SPLIT SECOND WITH THE STARS

    IN SANATANA DHARMA THERE IS NO BIG BANG

    BRAHMA INHALES AND ALL VIBRATION STOPS--MATTER DISAPPEARS

    ONLY ENERGY FIELD REMAINS

    BRAHMA THEN EXHALES AND VIBRATIONS STARTS --MATTER APPEARS AGAIN

    CHANGE IS THE ONLY CONSTANT , THIS IS THE MESSAGE ON BHAGAWAD GITA

    SEIZE THE MOMENT --SAYS KRISHNA TO ARJUNA -- THE TIME IS NOW

    ROTHSCHILDs FREEMASON AGENT MAD MAN CHARLES DARWIN CALLED EVOLUTION FROM MONKEY TO MAN

    IN THIS DNA AGE--OUR NCERT BOOKS STILL TEACH US DARWINS MAD THEORY OF EVOLUTION

    EVOLUTION IS OF SOUL

    EVERY LIVING THING HAS A SOUL

    BRAHMAN ( FIELD ) SHEARED OFF PARTS OF HIS OWN BODY , LOWERED THE FREQUENCY AND SEND THESE SOULS ON PLANET EARTH

    THESE SOULS EXISTED INSIDE ALL FORMS OF LIFE

    WHEN THE SOUL ENTERED CONSCIOUS HUMANS LAWS OF KARMA PREVAILS

    AS THE KARMIC BAGGAGE IS REDUCED THE SOUL FREQUENCY INCREASES

    THE SOUL SKIPS FROM FIRST ASTRAL LAYER--LAYER BY LAYER -- TILL THE SOUL FREQUENCY IS HIGHEST AND SAME AS THE MOTHER FIELD OF BRAHMAN.

    SOUL THEN MERGES BACK WITH MOTHER FIELD, ON THE SEVENTH ASTRAL LAYER OF VAIKUNTA .

    BRAHMAN KNOWS EVERY THING- TRILLIONS OF SOULS GAVE FEEDBACK IN A CLOSED LOOP TO GOD

    http://ajitvadakayil.blogspot.in/2014/07/nasadiya-sukta-rig-veda-5000-bc.html

    capt ajit vadakayil
    ..



HINGES OF DESTINY ARE FORGED ON YOUR OWN TERMS 








WW2 SAW THE POWER OF THE ATOM NUCLEUS,   MENTIONED IN 7000 YEAR OLD VEDAS -- 

 ALMOST ALL SHOCKED WESTERN SCIENTISTS WROTE IN THEIR WILLS THAT THEY WANT TO BE CREMATED--  

THE POWER OF BRAHMAN ( EMPTY SPACE WITHIN ATOM ) CAN BOIL OFF OCEANS IN SECONDS

IMAGINE WW1 WAS FOUGHT WITH STUPID NEWTONS PROJECTILES.





Bhastrika or the bellows type of pranayama expels the gases from the stomach. One feels like belching while performing bhastrika.  The recti and the other anterior abdominal wall muscles are well exercised during bhastrika. If these muscles are properly developed, the intestines and other organs in the abdominal cavity get proper support from the front. These organs are attached to the spinal column and are loosely hanging in the abdominal cavity. If they have no support in front, they cause a stretch on the lumbar spine leading to low back pain. But by developing the front muscles, and affording a support to intestines from the front, this strain on the spine is lessened, and the back pain is relieved. Due to this frontal support, the circulation of the intestines improves and hence they function better.  There is a lot of stagnant blood collected in the splanchic venous pool of the intestines. This stagnant blood is pumped out thus increasing the amount of blood in circulation. Bhastrika exercises the diaphragm, which is a major component in the process of respiration, and renews the residual air in the lungs. Bhastrika like Kapalbhatti is a process of hyperventilation, leading to respiratory alkalosis, which has a  so called “ soothing effect” on the respiratory centre.  I WARN my readers , this must not be overdone.  YOGA IS ONLY ABOUT DEEP DIAPHRAGMATIC BREATHING . HYPERVENTILATION IS NOT ALLOWED.  I mention this type of Bhastrika pranayama only because we can perform a better kumbhaka after doing bhastrika.  Bhastrika also has certain yogic influences on the anahata and manipura chakras and must be done only on a gradual ascending curve.




Below: BREATHING IN YOGA IS AS BELOW DEEP SLOW DIAPHRAGMATIC BREATHING -- NEVER HYPERVENTILATION OR SHALLOW FAST CHEST BREATHING .


This is the ONLY way to breathe while living on this planet , it stimulates the vagus nerve -- teach your children - tell your sons NOT to hold the stomach IN, just to impress ze girls with a flat tummy.   If ALL breathes this way EVIL PHARMA will soon have to shut shop  .


The secrets of the Lymph node system was written down in Charaka Samhita 6200 years ago.  Yogic deep belly breathing aids in increasing lymph and blood flow allowing those systems to work more efficiently. This creates reduced blood pressure and a healthier state of tissue and eliminatory system.

TRIPLE ENZYME SRI DEVELOPED AND PATENTED HIS SUDARSHAN KRIYA HYPERVENTILATION , WHICH DESTROYS BRAIN CELLS IRREVERSIBLY.  HE HAS GOT SOME STUPID JAP DOCTOR TO PRAISE HE FAKE BREATHING , WHICH IS NOT YOGA.






BELOW: GENERATING NITRIC OXIDE BY OMMMMMMMM.  THUMB IN EARS . FINGERS OVER EYES .


CAPT AJIT VADAKAYIL REPEATS AGAIN,  HYPERVENTILATION IS NOT ALLOWED IN YOGA . 

YOGA HAS SHUNNED HYPERVENTILATION , AND HAS USED BHASTRIKA PRANAYAMA ONLY TO SHIFT THE DOMINANT NOSTRIL ( IDA / PINGALA )  FOR A FEW SECONDS.


Protect yourself against chest breathing, mouth breathing ( sleep apnea etc ) and hyperventilation.  Never join a yoga class where they teach PATENTED hyperventilation and this is against the tenets and basic principle of  ancient Yoga. 6000 year old Ayurveda shuns hyperventilation and chest breathing.  I am from Kerala, the land of Ayurveda.  Brain diseases (or disorders of the central nervous system - CNS) are possible only in conditions of chronic hyperventilation, chest breathing and mouth breathing.  Sanatana Dharma does NOT allow you to create HARMFUL YOGA , patent it , make moolah and live like kings--and run down the wooden ramp through a gaping crowd ,like a MESSIAH  ( all the while hiding the bouncing gangantuan pauch with a white shawl )

Hyperventilation leads to "spontaneous and asynchronous firing of neurons". This is why white people have panic attacks, seizures, sleeping problems, anxiety breathing disorders, depression, bipolar disorder, senile dementia, Parkinson, Alzheimer disease, anxiety, panic phobia, depression, migraine, and idiopathic seizures.Anything which EVIL PHARMA does NOT know is termed genetic disease. They send their agents to deep Indian jungles and use our tribals ( with unpolluted bodies ) as lab rats. These conscious brain tests cannot be done on lab rats or animals. Only human beings can see in colour or can see themselves in the mirror ( leaving aside a handful of animals like chimps, dolphins , elephants etc ). Hyperventilation and abnormal electrical signals in the brain take place simultaneously.  Chest breathing results in drastic reduction of blood oxygenation since lower parts of the lungs get more than 7  times richer blood supply.  Adverse  biochemical and immune effects of mouth/ chest breathing are too numerous and too shocking to even expound . Our diaphragm flattens when we are stressed and we begin to breathe shallowly and faster , which raises our stress level even more. Changing your breathing pattern is an important step in reducing stress. When we do deep diaphragmatic breathing, our stress levels will decrease because it allows more oxygen to flow through the body. Yogic breathing puts us in a parasympathetic (calm and relaxed) from a sympathetic (fight or flight) nervous system.  It optimizes the carbon dioxide (CO2) and oxygen (O2) exchange in the lungs to give greater space in the thoracic cavity during inhalation.  A better CO2/O2 exchange also allows for higher oxygen saturation in our blood. The diaphragm is also an important muscle in core stabilization, working with internal and external obliques, the quadratus lumborum, transverse abdominis and pelvic floor.  


I am a Chemical tanker captain,  a practical and theoretical  expert on Oxygen / Carbon dioxide/ Nitrogen . 

I know what is Martini effect and Nitrogen Narcosis .

I am not some stupid lying FAKE guru , with gift of gab, without a technical brain, who lectures at UN/ International Free Mason seminars -

-who milks Hinduism and gives the sponsor  Zionist Jews what they want to hear--

blah blah-- HOMOSEXUALITY VERY VERY GOOD -- SANCTIONED BY VEDAS -- OK TO SHOVE YOUR PRICK INTO A MALE ASSHOLE BEHIND CLOSED DOORS-- blah blah 

THESE EVIL AND IGNORANT FAKE HINDU GURUS, SPONSORED BY BENAMI MEDIA  , WILL SUFFER FROM BAD KARMA.  

TODAY THEY SHINE -- LET ME SEE HOW MUCH THEY SHINE AFTER TWO DECADES.    


The horizontal and vertical movement of the muscles massages the abdominal organs aiding in peristalsis and detoxification of the organs, providing better digestive and bowel function. It breaks the pain cycle by reducing muscle tension and tension headaches. Yogic deep diaphragmatic breathing has higher ideals than an expensive massage.   Massage causes movement of blood and lymph, oxygenating our tissues, reducing muscle tension, and helping detoxify our body by ridding it of waste.   Yoga does NOT allow you to eat like a glutton. Having an overfull stomach causes you to do chest breathing.MORBIDLY OBESE PEOPLE CAN REDUCE WEIGHT BY YOGIC BREATHING--FAT GOES OUT AS SHIT  Deep diaphragmatic breathing stimulates the cleansing work of the lymph system by creating a negative pressure pulling the lymph through the lymph system. This increases the rate of elimination of toxins from visceral organs by more than 16 TIMES..  Lymph nodes connected to the stomach, kidneys, liver, pancreas, spleen, large and small colons, and other vital organs are located just under the diaphragm - over 62% of all lymph nodes in total! 

When we breathe more air, by hyperventilation, we get less oxygen in body cells. In fact, the slower your automatic breathing pattern at rest (down to only 3 breaths/min), the larger the amount of oxygen delivered to cells. 

I SENT MY WIFE TO EXPERIENCE THE SUDARSHAN KRIYA , HYPERVENTILATION OF SRI SRI RAVISHANKAR, WITH PROPER INTRUCTIONS .  SHE DID IT EXACTLY THE WAY IT WAS TOLD .  

HER BODY EXTREMES STARTED TINGLING / VIBRATING/ CARPOPEDAL SPASMS,  LIKE WHEN YOU SIT IN FRONT OF A POWERFUL FAN 


SHE WAS CONSTRAINED TO TUCK HER LEGS AND HANDS WITHIN HER BODY AND THEN TELL THE TEACHER THAT SHE WONT DO THIS NONSENSE ANYMORE.


Hyperventilation occurs when the rate and quantity of alveolar ventilation of carbon dioxide exceeds the body's production of carbon dioxide. Hyperventilation can be voluntary or involuntary.  When alveolar ventilation is excessive, more carbon dioxide will be removed from the blood stream than the body can produce. This causes the concentration of carbon dioxide in the blood stream to fall and produces a state known as hypocapnia. The body normally attempts to compensate for this metabolically. If excess ventilation cannot be compensated metabolically, it will lead to a rise in blood pH. This rise in blood pH is known as respiratory alkalosis. When hyperventilation leads to respiratory alkalosis, it may cause a number of physical symptoms: dizziness, tingling in the lips, hands or feet, headache, weakness, fainting and seizures. In extreme cases it can cause carpopedal spasms (flapping and contraction of the hands and feet).In normal breathing, both the depth and frequency of breaths are varied by the neural (or nervous) system, primarily in order to maintain normal amounts of carbon dioxide but also to supply appropriate levels of oxygen to the body's tissues. This is mainly achieved by measuring the carbon dioxide content of the blood; normally, a high carbon dioxide concentration signals a low oxygen concentration, as we breathe in oxygen and breathe out carbon dioxide at the same time, and the body's cells use oxygen to burn fuel molecules, making carbon dioxide as a by-product. Normal minute ventilation is generally 5–8 liters of air per minute at rest for a 70 kg man. If carbon dioxide levels are high, the body assumes that oxygen levels are low, and accordingly, the brain's blood vessels dilate to assure sufficient blood flow and supply of oxygen. Conversely, low carbon dioxide levels cause the brain's blood vessels to constrict, resulting in reduced blood flow to the brain and lightheadedness. The gases in the alveoli of the lungs are nearly in equilibrium with the gases in the blood. Normally, less than 10% of the gas in the alveoli is replaced with each breath taken. Deeper or quicker breaths as in hyperventilation exchange more of the alveolar gas with ambient air and have the net effect of expelling more carbon dioxide from the body, since the carbon dioxide concentration in normal air is very low. The resulting low concentration of carbon dioxide in the blood is known as hypocapnia. Since carbon dioxide is carried as bicarbonate in the blood, the loss of carbon dioxide will drive bicarbonate to combine with hydrogen ions (protons) to form more carbon dioxide. The loss of hydrogen ions results in the blood becoming alkaline, i.e. the blood pH value rises. This is known as a respiratory alkalosis. This alkalization of the blood causes vessels to constrict (vasoconstriction). The high pH value resulting from hyperventilation also reduces the level of available calcium (hypocalcemia), which affects the nerves and muscles, causing constriction of blood vessels and tingling. This occurs because alkalization of the plasma proteins (mainly albumin) increases their calcium binding affinity, thereby reducing free ionized calcium levels in the blood. Therefore, low levels of carbon dioxide can cause tetany by altering the albumin binding of calcium such that the ionised (physiologically influencing) fraction of calcium is reduced.Therefore, there are two main mechanisms that contribute to the cerebral vasoconstriction that is responsible for the lightheadedness, paresthesia, and fainting often seen with hyperventilation. Stupid people think that this most damaging thing is a good thingy.   One mechanism is that low carbon dioxide (hypocapnia) causes increased blood pH level (respiratory alkalosis), causing blood vessels to constrict. The other mechanism is that the alkalosis causes decreased freely ionized blood calcium, thereby causing cell membrane instability and subsequent vasoconstriction and paresthesia.

WARNING--WARNING--WARNING 





I once joined a BRAND NEW Chemical tanker . They had destroyed the Zinc Silicate coating of cargo tanks . All were at a loss—till I brought the white skinnedd European CHOOTS from darkness to light.


QUOTE:  Once i joined a chemical tankers with zinc silicate coating, with zinc shedding-- and coating permanently destroyed. Zinc Silicate coating cannot take pH l outside the range 6 to 9. When you produce DI / Demi water with 2 bed systems -- you have to be careful. Taste the water to see if it is NOT sour ( acidic ) . Filtered water is first passed through cation exchange cylinder which removes CA2+/ MG2+ ( water hardness ions ) cations from it and an equivalent amount of H+ ions are released into the water. The water is now softened.  (THIS ACIDIC WATER CAN DESTROY YOUR ZINC SILICATE COATING WHICH CANNOT TAKE pH LESS THAN 6.) Then this water is passed through an anion exchange cylinder which removes SO42- CL- ( chlorides ) anions from it and an equivalent amount of OH- ions are released into the water. The chlorides are now removed. The water is now called de ionized water or de mineralized water: UNQUOTE 





OUR TRIPLE ENZYME SRI CALLED SOUR VINEGAR MADE FROM ROTTEN VEGGIE / FRUIT WASTE AND PEELS – YAMUNA RIVER ENZYME !!

Anesthetic drug dosages can be reduced by mechanically hyperventilating patients under general anesthesia.  Patients under anesthesia were noted to sweat in a cold surgical theatre in the past which set surgeons /  anesthesiologist wondering .  This effect is but one of the several fascinating effects of hyperventilation on the human body. 

BELOW: 

WHAT THIS DOCTOR SAYS IN THE VIDEO WAS KNOWN TO OUR ANCIENT MAHARISHIS.  

CHECK OUT THE PARADOX OF HYPERVENTILATION -- 

FAKE GURUS WITHOUT TECHNICAL BRAINS ARE CLUELESS .

NOBODY MUST DO PRANAYAMA , UNLESS HE SEES THIS VIDEO BELOW.

FAKE GURUS SPONSORED BY ZIONIST JEWS , AND WHO PRAISE ANAL SEX , THINK BY PRANAYAMA YOU BREATHE MORE OXYGEN -- 

THE TRUTH IS REVERSE -- 

SEE I AM A PARADOX LOVER !!




Hyperventilation exerts so many effects upon the body relevant to anesthesia and the functioning of the brain, that it cannot be left to FAKE gurus sponsored by Zionist Jews.

I ask these FAKE gurus to take it easy with hyperventilation ( unless they want to spend their remaining lives in jail ) as thousands of people have died and got brain damage in the recent past. 

This is NOT as mundane and easy as enzymes in Yamuna river. 

You are playing with human lives by patenting FAKE yoga ( hyperventilation ). 

In the video above which shows children getting knocked unconscious, they just show 2%.   

Out of social responsibility I wont tell the balance 98%.

This is why parts of Atharva Veda / Kalari marmas  were never written down.

Respected Sir,
Sir you have said that Brahman shears off parts of himself for a journey on earth and evolution of soul.why does He have to do this when he is the creator,the all knowing,the omnipresent and omnipotent.what is the reason for this experiment.What does He have to know from this journey on earth when the laws of the universe are made by Him and when everything is his.
thank you




  1. SANATANA DHARMA AND VEDANTA IS QUANTUM PHYSICS.

    YOU DONT UNDERSTAND "CLOSED FEEDBACK LOOP"-- SO I WONT WASTE TIME ON THIS. AS A SHIP CAPTAIN I KNOW AUTOMATION .

    WE DONT MAKE A SAINT OUT OF MOTHER TERESA ( LIKE THE POPE ) BY BULLSHIT MIRACLES.

    THE ULTIMATE GURU TEACHES BY PERSONAL EXPERIENCE , AS EXPERIENCE IS THE ONLY SOURCE OF KNOWLEDGE . NOTHING IS REAL UNLESS EXPERIENCED .

    ANYWAY I DONT WANT TO LAUNCH INTO "EVOLUTION " - IT IS BEYOND THE SCOPE OF YOUR QUESTION .

    WHEN MY WIFE DELIVERED BY FIRST SON, I ASKED HER TO WITNESS HER OWN BODY--EVERY PAIN AND ACHE-- SHE TOLD ME

    I DONT GET IMPRESSED BY STUPID WOMEN WHO BOAST ON TV ABOUT THE HAJAAAAR  PAINS OF LABOR TO CUT A MAN DOWN TO SIZE.
Carbon dioxide is a byproduct of the energy-generating chemical reactions occurring within the cells of the body. Carbon dioxide produced by these chemical reactions within the cells of the body diffuses into blood which transports it into the lungs where it is eliminated from the body in exhaled air.

 But carbon dioxide is not just an inert waste product. 

It is also a vital component in the maintenance of the chemical environment of the body, because it also regulates the acidity of blood, as well as other fluids outside and inside each cell of the body.

Regulation of acidity and alkalinity within the tissues of the body is extremely important. The machinery of the body is driven by myriad complex chemical reactions, and the sum total of these chemical reactions result in optimally healthy body function at a certain levels of acidity and alkalinity inside and outside the cells of the body. 

Acidity and alkalinity of fluids is expressed in terms of the “pH”, a scale varying from 0 to 14. A pH = 0 is maximally acid, a pH = 7 designates neutrality, being neither acid nor alkaline, while a pH =14 is maximally alkaline. A fluid is acid if the pH is less than 7, and is alkaline if the pH is greater than 7. Blood is slightly alkaline with a pH = 7.4, while the insides of cells are slightly acid with a pH = 6.9.

Carbon dioxide (CO2) reacts reversibly with water (H2O) to form carbonic acid (H2CO3). But carbonic acid is unstable at body temperature and is usually in the ionized state, forming hydrogen ion (H+), and bicarbonate ion (HCO3-) as in the chemical equation below.

CO2 + H2CO3 H+ + HCO3-

At any given partial pressure of carbon dioxide within the tissues of the body, a balance exists between carbon dioxide and the bicarbonate concentration. This balance between carbon dioxide and bicarbonate ion determines the pH in blood and other tissues of the body. The Henderson-Hasselbach equation used to calculate the pH in blood shows this relationship in mathematical form.

pH = 6.1 + log[HCO3-] ÷ (0.03 × PCO2)


The normal partial pressure of carbon dioxide in arterial blood is about 40 mmHg, and the normal bicarbonate concentration is about 24 millimoles per liter. Put these figures into the Henderson-Hasselbach equation above, and you get the pH of arterial blood which is 7.4.


As mentioned above, the concentration of bicarbonate in blood is 24 millimoles per liter. This is also true for all the fluids in between the cells of the body. Inside the cells of most tissues, the bicarbonate concentration is about 8 millimoles per liter. This means there is a lot of bicarbonate in the body. It takes time before such a large mass of bicarbonate ion decreases, or increases in size as a result of changes in blood carbon dioxide concentration. And it is this large mass of bicarbonate that lies at the origin of the effects of hyperventilation. 

So what is hyperventilation?

In practical terms, all carbon dioxide is eliminated from the body as a gas in exhaled air. When the volumes of air breathed into and out of the lungs increases above what is normal, more carbon dioxide than normal is eliminated from the body. This lowers the pressure of carbon dioxide within the body, whereby carbonic acid changes back to into water and carbon dioxide, eventually resulting in a new equilibrium between bicarbonate ion and carbon dioxide.

CO2 + H2O ← H2CO3 ← H+ + HCO3-

But this spontaneous chemical reaction whereby carbonic acid returns to water and carbon dioxide, is not as rapid as the speed with which carbon dioxide is removed from the body by hyperventilation. So when body carbon dioxide pressure is suddenly lowered relative to the bicarbonate concentration, the pH increases above normal because the bicarbonate concentration does not decrease as rapidly. The condition where pH of the body is increased above normal is called “alkalosis”, and all the body fluids and cells become more alkaline than normal. This effect lies at the basis of the mental effects of hyperventilation. 

So what are the mental effects of hyperventilation?

PEOPLE WHO DO CHEST BREATHING AND HYPERVENTILATION BECOME FAT OBESE CHOOTS !

KUMBAKA PRANAYAMA IS THE SECRET TO BRUTE STRENGTH -- 

OH BLIMEY, GAVE AWAY THE SECRET WHY 60 YEAR OLD VADAKAYIL IS STRONG- 

 INDIAN WEIGHT LIFTING COACHES MUST BE TRAINED !

PUT THE LINK  BELOW, IN THE PMs , SPORT MINISTERs , HOME MINISTERS AND DEFENCE MINISTERS WEBSITES 



WW2 fighter pilots found out clouding of consciousness and unconsciousness became increasingly likely when the carbon dioxide pressure fell below 30 mmHg  -- that all people developed neurological symptoms due to hyperventilation at a carbon dioxide pressure of 20 mmHg .

People with hyperventilation commonly describe symptoms such as disturbed mentation, impaired concentration, poor memory, and hallucinations. Feelings of depersonalization are also common, where hyperventilating persons describe sensations of unreality, or feeling everything is confused and dream-like. Hallucinating effects have been used by FAKE gurus to make an ass out of devotees..

Visual experiences such as blurred vision, tunnel vision, flashing lights, and seeing double also occur).  Hyperventilation can cause brain death.

Patients with severe COPD, who were admitted to an intensive care, underwent mechanical ventilation, and shortly afterwards developed unmanageable epileptic convulsions, severe brain damage, and even brain death .Changes in body function caused by hyperventilation explain these deaths, as well as explaining the mental and visual manifestations of hyperventilation. The acidity and alkalinity of bodily fluids is determined by the relative difference between the concentration of bicarbonate and the pressure of carbon dioxide as expressed by the Henderson-Hasselbach equation . For the situation in arterial blood, the normal PCO2 = 40 mmHg, and the [HCO3-] = 24 millimoles, this means that the “bicarbonate / carbon dioxide ratio” is about 0.6. If the ratio is larger than 0.6, a fluid or tissue will be alkaline because this means there is less carbon dioxide due to hyperventilation. And when the ratio is less than 0.6, this means the fluid or tissue is acid.

Now people with severe chronic obstructive airways disease often have a higher than normal carbon dioxide concentration in their blood, simply because they cannot breathe deeply and rapidly enough to remove all the waste carbon dioxide from their bodies. And because the carbon dioxide concentration is higher than normal, this drives the chemical equilibrium to the right such that more carbonic acid is made.

CO2 + H2O → H2CO3 → H+ + HCO3-

The carbonic acid dissociates into hydrogen ion and bicarbonate ion. Eventually the relative concentrations of bicarbonate ion and the pressure of carbon dioxide are such that the ratio of 0.6 is achieved, and the pH once again equals 7.4.

Now just imagine this man was admitted to the intensive care with respiratory failure, where he was treated with mechanical ventilation of his lungs. Imagine that overenthusiastic physicians adjusted the mechanical ventilator such that his arterial carbon dioxide pressure was rapidly lowered to the normal level of 40 mmHg. Because carbon dioxide is more rapidly eliminated from the body than the bicarbonate concentration changes, the resulting bicarbonate / carbon dioxide ratio would be = 55 / 40 = 1.38, which indicates his blood would suddenly become very alkaline. If we calculate the exact pH, the resulting pH in his arterial blood would = 7.76. This means his blood would very rapidly become very alkaline indeed. This effect is true hyperventilation, because the change of carbon dioxide pressure is relative to the original carbon dioxide pressure in an abnormal equilibrium state. Such changes can profoundly affect the functioning of the body.

The flow of blood through the brain is called the “cerebral blood flow”. The normal flow of blood through the adult human brain is about 50 milliliters blood per 100 gm brain tissue per minute (50 ml/100 gm/min)

Unethical Hypoxia flows ( deficiency in the amount of oxygen reaching the tissues)  and hyperventilation experiments were conducted by the sadist Jap doctor Dr Shiro Ishii and shared with USA—at the expense of Chinese. 

This is why Chinese hate Japan and USA.  

These wounds on China will NEVER heal.





THIS BLOGSITE ASKS THE INDIAN GOVT TO PROFILE ALL TRAITORS AND DESH DROHIS.   

ENOUGH IS ENOUGH ! 

Below: A Pakistani terrorist praising Barkha Dutt 



WARN THEM FIRST AND THEN PUNISH THEM AS PER LAWS OF THE LAND .




Hyperventilation reduces the cerebral blood flow by causing constriction [narrowing] of the arteries supplying the brain with blood

Cerebral blood flow is directly related to the carbon dioxide pressure in the blood, and inversely related to the pH of the blood flowing through the arteries going to the brain . In other words, the lower the carbon dioxide pressure in the blood, the lower the cerebral blood flow  All people develop neurological manifestations due to hyperventilation below an arterial carbon dioxide pressure of 20 mmHg.

Extreme levels of hyperventilation, where the carbon dioxide pressure drops below 25-30 mmHg cause the cerebral blood flow to drop below 40 ml/100 gm/min, a level below which increasingly more people develop manifestations of cerebral hypoxia

Binding of oxygen with hemoglobin provides further evidence that hyperventilation may well cause brain tissue hypoxia.

Blood is a transport fluid. It transports oxygen, electrolytes, proteins, hormones, fats and sugars to tissues, and removes waste products of metabolism, hormones, products of metabolisms, etc away from tissues. Oxygen is transported by blood from the lungs where it enters the body. 

However oxygen is very poorly soluble in blood, and blood contains negligible amounts of dissolved oxygen. Practically all oxygen in blood is chemically bound to hemoglobin inside red blood cells. But the chemical binding of oxygen with hemoglobin is directly affected by the acidity and alkalinity of blood (i.e. the pH of blood).



AGAIN I REPEAT

THE WHITE MAN DID NOT HAVE A SINGLE INVENTION OR DISCOVERY IN HIS NAME TILL HE INVADED INDIA

BEFORE HE INVADED INDIA EVERY VESTIGE OF WESTERN KNOWLEDGE WAS STOLEN AND PATENTED.

WHEN KODUNGALLUR UNIVERSITY CAME TO KNOW THAT PYTHAGORAS/ PLATO/ ARISTOTLE / SOCRATES ETC WERE PATENTING INDIAN KNOWLEDGE IN THEIR OWN NAMES , THEY STOPPED TAKING GREEKS AS STUDENTS .

THIS IS WHY GREEK KNOWLEDGE FROM A GIANT WATERFALL CAME TO DRY ( NOT EVEN A TRICKLE ) SUDDENLY

THEN THE WHITE MAN STARTED STEALING FROM ARABS.

EVERY VESTIGE OF ARAB KNOWLEDGE WAS SOLD FOR GOLD --- TRANSLATED INTO ARABIC FROM KODUNGALLUR UNIVERSITY

NEVER MIND ZAKIR NAIKS CRIES--

AL HULL BULL INVENTED -PHYSICS
AL KULL BRRR INVENTED - MATH
AL BULL PRRR INVENTED - CHEMISTRY
AND SO ON

THIS IS A MAN WHO GIVES AWAY HIS OWN WATANs KNOWLEDGE TO ARABS SO THAT HE CAN GET MONEY FROM ARAB KINGS ..

capt ajit vadakayil
..


Hyperventilation causes loss of carbon dioxide from the body, causing the pH of blood to increase and become more alkaline. When blood is more alkaline, hemoglobin binds more tightly with oxygen. 

Oxygen bound to hemoglobin within red blood cells does nothing, because binding of oxygen to hemoglobin within red blood cells is no more than the body's method of transporting oxygen to the capillaries within the tissues of the body. Within the capillaries of the tissues of the body, the chemical bond between oxygen and hemoglobin is weak enough to allow oxygen to leave the blood and diffuse into the cells surrounding the capillaries, so providing oxygen for the vital, energy-generating chemical processes within the cells forming the tissues of the body. 

But when hyperventilation causes oxygen to bind more tightly to hemoglobin, less oxygen is released to diffuse into the tissues surrounding the capillaries.  Hyperventilation can cause less oxygen to enter the tissues of the body from the capillaries, so resulting in hypoxia of the cells outside the blood vessels, even though the blood contains more than sufficient oxygen.

Hyperventilation has profound effects on the transport and delivery of oxygen to the tissues of the body. Hyperventilation reduces the cerebral blood flow, and to make matters worse, hyperventilation also causes oxygen to bind more tightly with hemoglobin. Both factors combine to reduce the availability of oxygen to the tissues of the brain, and can even cause cerebral hypoxia.


The tragic fatal effects of relative hyperventilation in humans with severe chronic obstructive airway disease, also reveals that hyperventilation in humans can result in cerebral hypoxia severe enough to cause actual brain damage and brain death . Hyperventilation has  been implicated as one of the potential causes of postoperative cognitive dysfunction.

Hypocapnia is a state of reduced carbon dioxide in the blood due to hyperventilation. 

Hyperventilation describes excessive ventilation of the lungs, beyond what is required to achieve normal arterial blood gases. Hyperventilation, or over-breathing, does not add oxygen to arterial blood. This is because under normal physiological states arterial blood is close to saturation with respect to oxygen and is simply not able to absorb more.  Hyperventilation has little effect on arterial pO2 and almost no effect on oxygen saturation which is nearly 100% under normal circumstances. Its main effect is to lower pCO2 and produce a respiratory alkalosis. 

If we breathe within normal parameters this mechanism works very well to deliver oxygen to brain and body tissues. By contrast, over-breathing (i.e breathing more than the physiological norm) can upset this delicate balance thereby reducing oxygen delivery to cells.  Hyperventilation does not only reduce the total cerebral blood flow, but also changes the distribution of blood flow within the brain. Modern studies reveal that blood flow to the frontal, occipital, and parieto-occipital cortex , as well as the hippocampus is reduced relative to other areas of the brain within seconds to minutes of commencing hyperventilation.


USELESS patented Sudarshan Kriya is the Yoga equivalent of FAKE Shakti oil of TRIPLE ENZYME SRI

TRIPLE SRI fellow has PATENTED this Sudharshan Kriya by trying to rehash Yogic pranayama exercises like Bhastrika and Kapalabhati. 

TRIPLE SRI RAVISHANKAR IS A BOARD MEMBER IN ISRAEL’S ELIJAH INTERFAITH INSTITUTE FOUNDED BY RABBI GOSHEN-GOTTSTEIN .

It is against the dharma of a Hindu guru to patent anything. 

The ancient maharishis had depersonalized themselves in the search for truth-- unlike modern Western philosophers who lift ideas and patent it in their names.  

The sages who gave them to us did not care to leave their names; the truths they set down in the Vedas and Upanishads were eternal, and the identity of those who arranged the words irrelevant.


Four years ago Triple Sri Ravishankar fooled the students of IIT  Kanpur with some bullshit oil drops.

Triple Sri called for a volunteer to come up on stage for a “patented” magic oil surprise demonstration.

One of the students from the back rows of the auditorium was chosen to share the dais.

The chosen volunteer, a male student wearing a black t-shirt with horizontal white stripes, was asked to extend his arm parallel to the floor, clinch his fist and resist the pulling down of his arm. 

Triple Sri  gripping the volunteer’s arm near the wrist, was able to pull down his arm easily over and over again, much to the amusement  of the naïve audience. 

He then produced from his pocket a small vial containing some oil.

The volunteer was then asked to rub and spread this oil over his arm. After the volunteer took a step back and a deep breath to relax, the whole exercise was repeated again – except this time Triple Sri with his gargantuan paunch struggled quite hard to pull down the volunteer’s arm, amazing the vast audience.

The volunteer, visibly impressed and believing that he had in fact become stronger in a matter of seconds after the application of the oil, went onto fall at the feet (cultural practice of surrender) of the extraordinary messiah Triple Sri.
  
Following the thundering applause from his gullible audience, Mr. Ravishankar went on to urge stronger volunteers to come forth.

The next male volunteer also went on to fall at the feet of Mr. Ravishankar after his new found strength.
   
The frenzy in the arena attracted a male "skeptic" from the audience to volunteer.

He was visibly unimpressed by the arm pull down test and the claim of instantaneous improvement of strength and vigor following the application of a few drops of oil. 

The skeptic boldly asked for permission to perform the same test on his own test subject on the dais.

While the skeptic readied his subjects, Triple Sri changed his track and launched into a astounding theory for his precious oil.

He spAke  “one drop of poison can destroy the body. Can it not destroy? One drop of poison can destroy the immune system. No? HOOO ? No ? The reverse can also happen – one drop of nectar can also strengthen your body.”

The stupefied audience gaped in awe.

What happened afterwards was most hilarious .  The “test subjects” chosen by the “skeptic” gave testimonies to the audience that they felt “something different,” and the skeptic had to agree, on the microphone, that he was convinced of the power of the messiah and his great oil.

The gullible IIT Kanpur audience could NOT stop clapping.
  
At that time Shakthi Drops, are sold for 25 Euros in 30ml vials on Art of Living’s EU website.

Triple Sri uses the reaction principle to trick all.  Push , relax a muscle and then pull.


Triple Sri’s oil which gives rocket boost in immunity and muscle strength is not even pseudo science – it is sheer fraud.




THIS FRAUD, I HAD PULLED OFF ON A VAIN GIRL IN MY GYM, TWO YEARS BEFORE TRIPLE SRI DID IN IIT.

THIS FEMALE USED TO OVER EXERCISE .

I WORE A BRACELET AROUSING HER CURIOSITY .

I MADE HER WEAR IT AND PULLED THIS STUNT OFF WITH THE ENTIRE GYM MEMBERS SURROUNDING US.

IT IS ABOUT UNDERSTANDING THE PARALLELOGRAM LAW OF FORCES AND ITS RESULTANT DIRECTION.


SHE WANTED TO BUT THE BRACELET OFF ME ON THE SPOT AND WENT RUSHING FOR HER PURSE..


BELOW: HOLOTROPIC BREATHWORK --  CONMANs HYPERVENTILATION YOGA--BASTARDS !



These relative changes in blood flow and electroencephalogram reflect reduced activity in these regions of the brain. The frontal lobes of the brain are required for cognitive functions such as memory, experience of time, directed attention, reflective consciousness, and the idea of self.. So hyperventilation induced cognitive changes such as disturbed mentation, impaired concentration, and poor memory, are readily explained by reduced frontal cortical function - nicely termed “transient hypofrontality”. 

The occipital cortex performs primary and secondary visual processing, while the parieto-occipital cortex integrates body sensory information into the body image.. Reduced function in these regions of the brain certainly explains other experiences occurring during hyperventilation, such as visual hallucinations, feelings of depersonalization, or feeling that everything is confused and dream-like.  All these things mean hyperventilation can temporarily induce profound changes in brain function and the resulting conscious mental function. 

These effects even form the basis for a particular form of FAKE psychotherapy ( con-man grabbing power ) during which patients perform prolonged hyperventilation - a brain damaging therapy called “Holotropic Breathwork”

BELOW: HOLOTROPIC BREATHWORK FOUNDERS --  CONMANs HYPERVENTILATION YOGA--BASTARDS !



ZIONIST  EVANGELIST CON-MEN ARE CREATING MORE AND MORE BULLSHIT ABOUT RED SEA PARTING , IN AS MUCH AS THEY NOW CONSIDER IT AS SWARA PRANAYAMA OF SHIVA OF IDA / PINGALA BREATHING —TEE HEEEEEE !

BLAH  BLAH--  This is spoken of symbolically in the Bible as the times when the waters of the Red Sea and the Jordan River parted, standing on the right and left hands, while the Hebrews passed dry shod through their midst and reached their goal. Since these two “Pass-overs” are really motionless, they are “dry” passages, motionless movement.- BLAH  BLAH  FUCKIN’ BLAH

AIYYYOOOOOOOOO !

BRAAAYYYYYYYYYYYYYY !!


I HAVE LISTENED TO THOUSANDS OF HOURS OF EVANGELIST TV CHANNELS –

NOT TO PICK UP ANYTHING USEFUL  - BUT TO GET Me KICKS  . . AND LAUGH MY GUTS OUT --


Most swimmers know that a short period of hyperventilation prior to diving allows them to extend the period they can spend underwater. But this not a safe technique, because sometimes people who hyperventilate prior to diving lose consciousness and drown while underwater.. 

Part of the reason why this technique works is the fact that breathing is mainly regulated by the pressure of carbon dioxide in the blood.   Increased carbon dioxide pressures in arterial blood stimulates breathing, and generates a desire to breathe. Decreased carbon dioxide pressure in blood causes breathing to slow, reducing the urge to breathe, sometimes entirely removing the urge to breathe. 

Arterial blood oxygen pressures measured in divers forced to surface due to the necessity to take a breath after prolonged dives preceded by hyperventilation, are sometimes low enough to cause loss of motor control , and sometimes even low enough to cause loss of consciousness in some people .

Loss of consciousness due to hypoxia is insidious, and is preceded by changes in mental state whereby affected people experience loss of insight, together with feelings of wellbeing.. This explains why many people do not even realize they are about to lose consciousness due to hypoxia. 

This is the reason why some people who hyperventilate prior to an underwater dive, sometimes lose consciousness due to cerebral hypoxia before feeling the necessity to surface and breathe. And once they lose consciousness while underwater, they subsequently drown if not rescued.

Anesthesiologists often exploit the various properties of hyperventilation during general anesthesia. For example:

During neurosurgical operations on the brain, anesthesiologists often apply hyperventilation to cause constriction of the blood vessels of the brain. This reduces the volume of blood inside blood vessels within the substance of the brain, so reducing the volume of the brain. Constriction of blood vessels also reduces bleeding. The combination of both effects results in better operating conditions for the neurosurgeon.

Hyperventilation below an arterial carbon dioxide pressure of 30 mmHg reduces the level of consciousness, and sometimes even induces loss of consciousness. One consequence of this is a reduction of drug dosages required for general anesthesia.

Hyperventilation is sometimes used at the end of operations to reduce the level of consciousness, as well as to prolong and intensify the actions of residual concentrations of anesthetic drugs.

How can hyperventilation intensify and prolong the actions of anesthetic drugs? The answer lies in the chemical nature of anesthetic drugs. Most drugs and most organic compounds are either weak acids or weak bases.

Anesthetic drugs are no different. In fact, except for thiopental, all anesthetic drugs are bases. Now a base interacts with water molecules to form an equilibrium between an ionized form and a non-ionized form. Just look at this chemical equilibrium where “H2O” is water, and “B” is the base molecule or drug. 

When such a weak base dissolves in water, it interacts with water to acquire a hydrogen ion (H+), resulting in a free negatively charged hydroxyl ion (OH) in the following manner.

B + H2O BH+ + OH-

For example, morphine is just such a weak base, so the interaction with water is just the same, and forms an equilibrium as below where the proportions ionized and unionized morphine are constant at each pH level.

Morphine + H2O MorphineH+ + OH-


Morphine is a weak base. So when blood becomes more acid, (i.e. the pH decreases), a greater proportion of morphine exists in the ionized form. On the other hand, when blood becomes more alkaline and the pH increases, a smaller proportion of morphine exists in the ionized form. The same is true for all other anesthetic drugs ( except for rapid-onset short-acting barbiturate thiopental ). This may sound like a chemical subtlety of little practical consequence, but the concept of ionization of drugs used in anesthesia has important practical consequences.


“The being who is the breath within– him I meditate upon as Brahman.…That which breathes in is thy Self, which is within all.…That which breathes out is thy Self, which is within all.…Breath is the abode of Brahman”--   (Brihadaranyaka Upanishad 2.1.6). 5000 BC


THIS POST IS NOW CONTINUED TO PART 60, BELOW-





CAPT AJIT VADAKAYIL
..








50 comments:

  1. sir how can a "A YOGI WHO KNOWS THE SECRETS OF IDA / SUSHUMNA/ PINGALA BREATHING CAN EVEN CHOOSE THE GENDER OF HIS CHILD " .

    Please elaborate sir

    ReplyDelete
    Replies
    1. I think it has something to do with left side of our body representing female side and right side representing male side. During intercourse I guess that it involves manipulation of breath on either side...

      Delete
  2. Was pushkara krishna started by the FAKE mutts of the white invader ?

    ReplyDelete
  3. http://www.ndtv.com/opinion/the-cowardice-and-iniquity-of-what-arnab-goswami-has-called-for-1437493

    HEY , LOOK WHO IS TALKING .

    just google -

    WORST JOURNALIST

    WHAT IS ITEM 1
    ON PAGE 1
    AMONG 30 MILLION POSTS ?

    OBVIOUSLY NOBODY WILL CONGRATULATE BARKHA DUTT ..

    FOR SHE IS THE MOST HATED WOMAN IN INDIA.

    I WILL MAKE SURE THAT BARKHA DUTT COMES UP AS ITEM 1 ON PAGE 1 --IN ANY INTERNET ENGINE SEARCH FOR -THE UGLIEST WOMAN . . ..

    OBVIOUSLY BARKHA DUTT AT THE AGE OF 45, WILL NEVER HAVE ANY CHILDREN WHO NEED TO DUCK FROM HER STINKING LEGACY .

    GOOD FOR THIS KALANK TO INDIAN JOURNALISM !

    THE JNU EPISODE REVEALED WHO THE DESH DROHIS ARE-- THIS INCLUDED ALMOST THE WHOLE OF BENAMI TV AND MEDIA .. .

    capt ajit vadakayil
    ..

    ReplyDelete
    Replies
    1. https://www.youtube.com/watch?v=Z14iN7mmHkY

      Delete
  4. https://www.youtube.com/watch?v=aT5e9RfnoN8

    WE WANT DESH DROHI MEDIA BEHIND BARS !!

    ReplyDelete
  5. http://operationdisclosure.blogspot.my/2016/07/60-false-flag-attacks-that-were.html

    ReplyDelete
  6. Namastey captain
    Balochistan is burning and crying due to genocide of pak.
    Its very good opportunity for india to give army protection to baloch and diminish the cruelty of pak army.

    ReplyDelete
    Replies
    1. This will take away the noble prize from Alice ...

      Delete
  7. Respected Captain, new machines that generate pure alkaline water by extraction moisture from air are now available. Is the water obtained from such machines really safe for drinking? Unlike traditional methods of water purification these new machines do not filter or purify existing ground water but they claim to generate pure drinking water from air through process of condensation similar to ACs. Kindly inform if this technology is safe for human consumption. Regards

    ReplyDelete
  8. Hello captain,
    Our kuldevta like "Tulja bhavani" , "Maa Saptashrungi ", and many others are true or they also the fake creation on Indian mutts.
    Best wishes

    ReplyDelete
  9. Hi Ajit,
    This is the Salt of Navbharat Times for TRP :http://navbharattimes.indiatimes.com/photomazza/glamour/playboy-models-photographed-up-to-60-years-later-define-the-bold-and-sexy-in-a-totaly-different-way/Marilyn-Cole-Lownes/photomazaashow/53479071.cms

    Sushanta Das

    ReplyDelete
  10. Hi Ajit,

    Now NDTV is arguing for the NGOs :https://twitter.com/ndtv/status/759812516977389568
    SUshanta Das

    ReplyDelete
    Replies
    1. WHEN DID NDTV LAST SUPPORT THE WATAN ?

      WHY IS MODI NOT FINING THIS TV STATION AND INCARCERATING THE DESH DROHIS OF NDTV -- CONSIDERING THEY FEEL IMMUNE AND ARE GETTING TOO COCKY ?

      OH I FORGOT-- MODI WANTS NOBEL PRIZE !

      Delete
    2. Hi Ajit,

      The same Old wine(AJ) in New Bottle(VN) for IB Ministry.I think this Ministry doing no credible work for last 2 Years. Yes Nobel toh Milega

      Sushanta Das

      Delete
  11. Captainji what you say about caryl matrisciana, she is spreading some lies about Hinduism and yoga

    ReplyDelete
  12. Sir,
    such a beautiful rendering and description of Brahman within... I thought of providing the link so that it will be helpful for the subsribers..

    https://www.youtube.com/watch?v=42RE6mlT6tI

    ReplyDelete
    Replies
    1. hi mc,

      WHEN YOU DIE

      YOU ARE NOT DEAD, IN REALITY

      YOU HAVE JUST DISCARDED YOUR OLD PHYSICAL BODY

      LIKE HOW YOUR REMOVED YOUR DIRTY JEANS FOR LAUNDRY

      YOUR SOUL WAS BORN WITH THE STARS

      YOUR SOUL WAS ONCE PART OF THE FIELD OF BRAHMAN

      YOUR SOUL WILL SOON MERGE BACK WITH THE MOTHER FIELD

      YOU ( SOUL ) ON GETTING MOKSHA , WILL DOWNLOAD ALL PAST EXPERIENCES THROUGH EVERY FORM OF LIFE ON PLANET EARTH INTO THE MOTHER FIELD-- LIKE HOW A PEN DRIVE DOWNLOADS INFO INTO THE HARD DRIVE OF THE COMPUTER

      WHAT IS THERE TO CRY ABOUT?

      YOUR GREAT GRANDFATHER , YOUR UNBORN GREAT GRANDSON WERE ALL BORN AT THE SAME SPLIT SECOND WITH THE STARS

      IN SANATANA DHARMA THERE IS NO BIG BANG

      BRAHMA INHALES AND ALL VIBRATION STOPS--MATTER DISAPPEARS

      ONLY ENERGY FIELD REMAINS

      BRAHMA THEN EXHALES AND VIBRATIONS STARTS --MATTER APPEARS AGAIN

      CHANGE IS THE ONLY CONSTANT , THIS IS THE MESSAGE ON BHAGAWAD GITA

      SEIZE THE MOMENT --SAYS KRISHNA TO ARJUNA -- THE TIME IS NOW

      ROTHSCHILDs FREEMASON AGENT MAD MAN CHARLES DARWIN CALLED EVOLUTION FROM MONKEY TO MAN

      IN THIS DNA AGE--OUR NCERT BOOKS STILL TEACH US DARWINS MAD THEORY OF EVOLUTION

      EVOLUTION IS OF SOUL

      EVERY LIVING THING HAS A SOUL

      BRAHMAN ( FIELD ) SHEARED OFF PARTS OF HIS OWN BODY , LOWERED THE FREQUENCY AND SEND THESE SOULS ON PLANET EARTH

      THESE SOULS EXISTED INSIDE ALL FORMS OF LIFE

      WHEN THE SOUL ENTERED CONSCIOUS HUMANS LAWS OF KARMA PREVAILS

      AS THE KARMIC BAGGAGE IS REDUCED THE SOUL FREQUENCY INCREASES

      THE SOUL SKIPS FROM FIRST ASTRAL LAYER--LAYER BY LAYER -- TILL THE SOUL FREQUENCY IS HIGHEST AND SAME AS THE MOTHER FIELD OF BRAHMAN.

      SOUL THEN MERGES BACK WITH MOTHER FIELD, ON THE SEVENTH ASTRAL LAYER OF VAIKUNTA .

      BRAHMAN KNOWS EVERY THING- TRILLIONS OF SOULS GAVE FEEDBACK IN A CLOSED LOOP TO GOD

      http://ajitvadakayil.blogspot.in/2014/07/nasadiya-sukta-rig-veda-5000-bc.html

      capt ajit vadakayil
      ..

      Delete
  13. http://www.ewao.com/a/groundbreaking-discovery-man-solves-teslas-secret-to-amplifying-power-by-nearly-5000/

    ReplyDelete

  14. Dillon
    August 1, 2016 at 12:55 AM
    Hello Capt Ajit Vadakayil

    I have been browsing your site for some time now and am thankful for all of your work. You have been able to effectively provide truth and history through your writing.

    I have one question though, and one that you might not be able to answer...But as a Hindu, with all of these Gods and Goddesses, and if the religion is true and Krishna did exist and all of the Vedic stories and such are fact not fiction...then...

    How could it be possible for a people so GREAT to be massacred and exploited on such a large scale by invaders of the wrong kind?

    First it was the Muslims
    Then it was the Christians
    Today it is society at large

    And if the laws of Karma are to be believed, the opposite has occurred!

    Again, my question is...where the HELL was GOD when the Muslim invasions were taking place in India?

    Was "Krishna" FAST ASLEEP?

    ReplyDelete
    Replies
    #################

    Capt. Ajit Vadakayil
    August 1, 2016 at 9:22 AM

    NEXT TIME , WE WONT GHUMAO CHARKHA , THE WAY APCO MODI WANTS .

    GUJJU NO 2 STILL DOES NOT HAVE THE BALLS TO PUNISH DESH DROHIS. HE IS SAFEGUARDING HIS OWN KURSSI.

    ADVERSITY HAS PREPARED ORDINARY INDIANS FOR EXTRAORDINARY DESTINY

    WAIT FOR 17 YEARS

    http://ajitvadakayil.blogspot.in/2011/07/unquantified-holocaust-and-genocide.html

    ReplyDelete
    Replies
    1. There is a lot of collective bad karma in India. We do a few things right but several things are wrong. We have been paying the price for the last 400 years. There is a certain ignorance and arrogance that is bringing about our downfall. Even if India rises in 17 years as per the Captain, it will be because the other countries have fallen. Our agrarian methods will outlast all other countries, we are blessed with rains and abundance of food. Western countries are not sustainable economically nor socially.

      One crucial character flaw is people looking up to white people and looking down upon their own people. White people do the opposite no matter how stupid their own people are. Also we have let the Talmudic (Zionist) Jew infiltrate via some Jains, Marwaris, Parsis etc, along with freemasons - if we are so easily duped we will pay the price.

      Delete
  15. http://www.geoengineeringwatch.org/geoengineering-is-fueling-deadly-epidemic-of-vitamin-d-deficiency/
    Very scary Captain

    ReplyDelete
  16. PRESSTITUTES DO NOT REQUIRE THEIR MONTH END SALARIES . . .

    THEY MAKE 50 TIMES MORE MOOLAH EVERY MONTH BY PAID NEWS . .

    HAVE YOU NOTICES THE PROLIFERATION OF FAALTHU PICTURES OF BOLLYWOOD STAR SONS/ DAUGHTERS NOW USING MEDIA ( LIKE FACEBOOK ) TO DISPLAY THEIR FAALTHU PHOREN HOLIDAY PICTURES . .

    WE DO NOT WANT VENKAIH NAIDU TO BE A MEDIA DARLING LIKE ARUN JAITLEY - - WHO IS THE PM IN WAITING , AANKH MEIN KOSHER SURMA DAALKE . .

    NAIDU MUST SET STANDARDS FOR MAIN STREAM MEDIA-- IF THEY DEVIATE OR SHOW ANY DESH DROHI BEHAVIOR -- FINE THEM FIRST . .LATER SUSPEND THEIR LICENCES . .

    ABOLISH NEWS BROADCASTERS ASSOCIATION- THEY DO MORE HARM TO THE WATAN THAN GOOD . .
    Capt ajit vadakayil
    ..

    ReplyDelete
  17. Respected Sir,
    Sir you have said that Brahman shears off parts of himself for a journey on earth and evolution of soul.why does He have to do this when he is the creator,the all knowing,the omnipresent and omnipotent.what is the reason for this experiment.What does He have to know from this journey on earth when the laws of the universe are made by Him and when everything is his.
    thank you

    ReplyDelete
    Replies
    1. SANATANA DHARMA AND VEDANTA IS QUANTUM PHYSICS.

      YOU DONT UNDERSTAND "CLOSED FEEDBACK LOOP"-- SO I WONT WASTE TIME ON THIS. AS A SHIP CAPTAIN I KNOW AUTOMATION .

      WE DONT MAKE A SAINT OUT OF MOTHER TERESA ( LIKE THE POPE ) BY BULLSHIT MIRACLES.

      THE ULTIMATE GURU TEACHES BY PERSONAL EXPERIENCE , AS EXPERIENCE IS THE ONLY SOURCE OF KNOWLEDGE . NOTHING IS REAL UNLESS EXPERIENCED .

      ANYWAY I DONT WANT TO LAUNCH INTO "EVOLUTION " - IT IS BEYOND THE SCOPE OF YOUR QUESTION .

      WHEN MY WIFE DELIVERED BY FIRST SON, I ASKED HER TO WITNESS HER OWN BODY--EVERY PAIN AND ACHE-- SHE TOLD ME

      I DONT GET IMPRESSED BY STUPID WOMEN WHO BOAST ON TV ABOUT THE PAINS OF LABOR TO CUT A MAN DOWN TO SIZE.

      Delete
    2. You are 100% right, experience can make you understand what cannot be described. People misunderstand witness for experience. When you witness something you can ONLY DESCRIBE WHAT YOU FEEL, and does not count as experience because you are not in the experience.

      For instance, if I see a couple kissing - I can only assume they are say engaged but they can be strangers as well.

      Let me give you a SIMPLE EXAMPLE:

      You can know everything, but you cannot experience everything. For instance I can CREATE a video game in which I know EVERYTHING but I can only experience my video game when I PLAY IT even though I ALREADY KNOW EVERYTHING.

      Closed feedback mechanism is simply putting the gained experience into yourself again and again to get a perfect understanding which is not possible for BRAHMAN because it itself is infinite, but it is perfect because it creates everything forever.

      Human mind has a special property - there are some things which we cannot describe, you will have to experience to understand what cannot be described. It is just the way it is.

      Ajit has always been 100% right about scientific facts about Vedanta because understanding depends on one's intelligence. The problem with people who diss Ajit are the ones who lack intelligence, and this is a fact. When I mean intelligence I mean the depth of thought, perception, logic and abstraction all combined into ONE.

      Delete
  18. Thank you for replying sir.
    i wanted to know all about BrahmAn as much as i can comprehend.

    ReplyDelete
  19. AJIT please respond to my this comment:

    And to be honest, your blogs keep me alive. I have LOST a LOT OF FRIENDS because I say everything you say. There is this anglo-Indian woman woman who is my friend's girlfriend who said Ajit is mad, etc

    So I said I can explain God and not describe which Hindus called BRAHJMAN> She started me telling bull stories on how Brahman created evreything but it was not perfect bla bla bla.

    I am like that is not Brahman. Brahman is a morphed field in which conscious controls the field, she got pissed off. She was one of my best friend's gf, who I helped him a lot. Now even he misses my calls, texts, etc

    I was also talking to these WHITE girls/guys - who were talking about how we cannot discover the origin of human bla bla. OI talked about Brahman, on how some things can only be understood but not descrivbed, etc etc I talked about outer space ebergied rock, etc gave them so much knowledge in which they understood NOTHING.

    I sent them a friend request - but what they did is when I went away they removed the friend request because I had just met them! This is how CUNNING the white PEOPLE are. Also they DO NOT UNDERSTAND anything they just keep on saying YES. THis is how the WHTE MAN HAS RULED - they are always in STRONG DENIAL ALWAYS but are DUMB.

    Not even a single invention of today would have been possible wrent it for Vedas - whether it be computer codes, bulb, aeronautics, perioidic table, etc Innovation, inventioon, et c whatever

    i mean even ELON MUSK's/NASA's space vehicle DRAGON has a striking resemblance to RUKMA VIMANA.

    And let me tell you on why INDIA got INVADED - white people are the MOST CUNNING people on this planet, who knows Universe. They create fantasy stories of theirs into realities and for this you need to interact with ordinary white people enough to know this - only by experience can you understand.

    ReplyDelete
    Replies
    1. AGAIN I REPEAT

      THE WHITE MAN DID NOT HAVE A SINGLE INVENTION OR DISCOVERY IN HIS NAME TILL HE INVADER INDIA

      BEFORE HE INVADED INDIA EVERY VESTIGE OF WESTERN KNOWLEDGE WAS STOLEN AND PATENTED.

      WHEN KODUNGALLUR UNIVERISTY CAME TO KNOW THAT PYTHAGORAS/ PLATO/ ARIDTOTLE / SOCRATES ETC WERE PATENTING INDIAN KNOWLEDGE IN THEIR OWN NAMES , THEY STOPPED TAKING GREEKS AS STUDENTS .

      THIS IS WHY GREEK KNOWLEDGE FROM A GIANT WATERFALL CAME TO DRY ( NOT EVEN A TRICKLE ) SUDDENLY

      THEN THE WHITE MAN STARTED STEALING FROM ARABS.

      EVERY VESTIGE OF ARAB KNOWLEDGE WAS SOLD FOR GOLD --- TRANSLATED INTO ARABIC FROM KODUNGALLUR UNIVERSITY

      NEVER MIND ZAKIR NAIKS CRIED

      AL HULL BULL INVENTED -PHYSICS
      AL KULL BRRR INVENTED - MATH
      AL BULL PRRR INVENTED - CHEMISTRY
      AND SO ON

      THIS IS A MAN WHO GIVES AAY HIS OWN WATANs KNOWLEDGE TO ARABS SO THAT HE CAN GET MONEY FROM ARAB KINGS

      capt ajit vadakayil
      ..

      Delete
    2. But also after invading India, they are still stealing from left over artifacts. There is no way microchip is suddenly created out of thin air, there is no way today's vehicles are constructed suddenly out of thin air, including vortex engines, radars, whatever.

      "The common man in the West certainly lives more princely than many a King centuries ago and enjoys marvels of genius which would have amazed the old magicians, yet the literature of Eastern peoples show that the Ancients sometimes surpassed us in the very things of which we are proud of. The Indian lyricize of spaceships faster than light and missiles more violent than H-bombs; their Sanskrit texts describe aircraft apparently with radar and cameras; the wonderful ‘Mahabahrata’ rivals the ‘Ilad’ and the ‘Odyssey’, the ‘Aeneid,’ the plays of Shakespeare and most of our modern fiction all combined. The religions and philosophies of the East distilled a sublimity of thought scarce attained in the West; the wonderful Indian system of Yoga, the Gnani Yoga of Wisdom, Raja Yoga of Mind, Hatha Yoga of Body, Bhakti Yoga of Love, Karma Yoga of Work, developed a discipline millennia ago blending mysticism with daily life, showing Man’s relation to the Universe incarnating ever upwards to perfection to Union with God; this supreme and beneficent teaching now exerting widening influence in our Western world must surely have sprung from civilizations long vanished…” - By W Raymond Drake

      Delete
    3. Razor, just curious to know what your need to convince others of your viewpoint stems from. In the Gita there is a line (Captainji maybe able to elaborate) that it is not our job to teach the ignorant. They are not ready to absorb the knowledge. At least not in this lifetime.

      Sorry for intruding but I don't think it is wise to lose friends over such a positive blog.

      Delete
    4. This German woman doing something good for Hindus from her blogs and in twitter.
      ”India is losing at least 2000 patents every year on traditional formulations as the knowledge on these has never been documented.”

      https://mariawirthblog.wordpress.com/2014/06/07/vedic-rishis-the-ancestors-of-all-indians/

      Delete
    5. Patents are all about money - the end of the current fiat system will restore natural order. Indians historically share knowledge not hoard it like a low level trader hoards money. Same thing happened with property it used to be family property that was shared but now every one needs their cut. It's the beginning of the end. Laws including patent laws are tools of the oppressor.

      Delete
  20. http://www.femina.in/relationships/love-sex/5-body-language-cues-that-lead-to-sex-14280.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    CHUTNEY MARYs DONT CARE FOR THE PEONs BODY LANGUAGE IN THE OFFICE TOILET

    SHE DOES NOT EVEN CARE FOR THE STINK AND THE DIRT

    ReplyDelete
  21. http://www.femina.in/relationships/love-sex/sex-facts-we-bet-you-didnt-know-14387.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    CHUTNEY MARY DOES NOT NEED CHICKEN SOUP

    SHE KEEPS AN EXTRA PANTY IN HER PURSE

    ReplyDelete
  22. Respected Sir,
    What are the after effects of tobacco consumption? How it effects brain? Initially there is a high but then it seems the brain is suspended and no power over it. Please enlighten.

    With regards,
    Himansu Panchal

    ReplyDelete
  23. Captain I am an iitian but only things I understand properly on ur blog is related to our course like Heisenberg principle and parallelogram law of addition etc.
    Aap mahaan ho

    ReplyDelete
  24. http://timesofindia.indiatimes.com/life-style/relationships/ask-the-expert/I-am-obsessed-with-my-married-neighbour/articleshow/48652984.cms

    CHUTNEY MARYS HAVE AN OBSESSION OF HAVING A NEW PEON IN THE OFFICE EVERY WEEK.

    THE DIRTIER THE BETTER . .

    ReplyDelete
  25. Hi Ajith

    Amusing --> http://www.thehindu.com/news/cities/Hyderabad/a-collective-student-agitation-can-topple-fascist-forces-says-kanhaiya/article8926714.ece?ref=yfp

    ReplyDelete
    Replies
    1. KANHAIYA KUMAR WILL SOON BE IN JAIL ALONG WITH HIS COMMIE MENTORS AND SPONSORS ( MEDIA BARONS )

      SEDITION MEANS GOING AGAINST THE WATAN

      SEDITION IS NOT GOING AGAINST AN ELECTED GOVT OR A RULER

      KAHAIYA KUMAR HAS GONE AGAINST BHARATMATA--THIS IS SEDITION

      Delete
    2. ################# SUBJECT-- STUDENTS PARLIAMENT TO DISCUSS ROHIT VEMULA #######################

      STUDENTS PARLIAMENT to drive wedges is the brainchild of BILDERBERG CLUB / NEW WORLD ORDER to make india implode internally . .

      In 1962 Indian commies took money from china and supported the enemy China against their own watan India. . . Before 1960 indian commies took money from Russia . .

      in 1942 QUIT INDIA MOVEMENT indian commies supported britain ( IN WRITING / FOLLOWED UP BY A PRAISE LETTER AFTER BRITAIN CRUSHED THE MOVEMENT ) --while the rest of india fought for the watan. . ..

      WHEN WE MOVE AGAINST TRAITORS-- JEW NOAM CHOMSKY EXERTS HIS STRANGE INFLUENCE ON THE COLLEGIUM JUDICIARY. . ..

      READ ALL 7 PARTS OF THE POST BELOW - ..

      punch into Google search -- -
      . . . . . . .. .. . . .FOREIGN FUNDED TROJAN HORSE NGOs , PIL, JUDICIAL OVERREACH, UNHOLY NEXUS VADAKAYIL .. . . . . . . . . . . .. .


      READ ALL 11 PARTS OF THE POST BELOW -- -

      Punch into Google search - - -
      . . . . . .. .. . JNU , DEN OF ANTI NATIONALS AND COMMUNIST CRIMINALS VADAKAYIL .. . . . . .. .

      capt ajit vadakayil
      ..

      Delete
  26. FOREIGN FUNDED NGOs NOW HAVE ENTERED SCHOOLS TO ASK CHILDREN TO PLEDGE THEIR ORGANS AND DONATE BLOOD . .

    WE ASK MODI TO CREATE A LAW , THAT IT IS ILLEGAL FOR INDIAN BLOOD AND ORGANS TO BE EXPORTED ABROAD OR ORGANS LIKE KIDNEYS TO BE FITTED ON TOURISTS WHO COME HERE WITH "VISA ON ARRIVAL"

    THE PUNISHMENT TO BLOOD BANKS AND ORGAN TRANSPLANT HOSPITALS MUST BE MOST SEVERE.

    WHISTLE BLOWERS WILL SPILL THE BEANS FOR A REWARD.

    capt ajit vadakayil
    ..

    ReplyDelete
  27. THE CARBON CREDIT/ OFFSET THINGY IS THE GREATEST HEIST SINCE WW2, WHERE JEW HITLER WORKING FOR JEW ROTHSCHILD CARVED OUT ISRAEL AND ALSO ELIMINATED THE EFFIMATE GAYS SELECTIVELY.

    OFFSETS ARE A LICENSE TO THE ZIONIST WEST TO POLLUTE AT WILL-- THE MOTHER OF ALL SCAMS

    They claim it is OK to increase emissions if they pay others to reduce them – the so-called “offset” projects. But it is a fallacy that offsets can neutralize the emissions caused elsewhere, especially offsets that involve storage of carbon in forests and soils.

    Emissions need to be cut at the source.

    THE BEEF LOBBY, GM FERTILISER LOBBY, THE NITRO EXPLOSIVES LOBBY ARE WARMING UP THE PLANET WITH NITROUS OXIDE.

    MIND YOU-- THE MOMENT A RESURGENT INDIA POINTS OUT TO THE BEEF /GM LOBBY THE ZIONIST JEWS WILL START NITROGEN CREDITS/ OFFSETS

    There are Zionist intermediaries who are the babies of Zionist Jew corporations that want to become "carbon-neutral" by purchasing offsets for the carbon dioxide they release.

    YOU DUMP METHANE/ NITROUS OXIDE AND THEN CRUNCH NUMBERS AND MAKE MONEY OUT OF THIN AIR.

    SEE I FARTED 200 TIMES--

    YEH LEH PAISA. TUM THODA KUM FART MAARO ( KAAGAZ KE OPAR )

    THIS IMMORAL CARBON SCAM IS LIKE A HOMOSEXUAL PEDOPHILE KEEPING OUT OF JAIL , BY SAYING THAT HE BOUGHT ASSHOLE HUMPING CREDITS

    MAATHARCHOD Al Gore has a large interest in a firm that sells carbon credits

    why is India planting bullshit trees, APCO Modi ? who has authorised rogues like Sadguru Jaggi Vasudev to planet trees which lower the ground water table --so that he can get an entry into Guinness book of world records ?

    ROTHSCHILDs US FEDERAL RESERVE MAKES MONEY OUT OF THIN AIR

    NOW THEY MAKE MORE MONEY FROM THIN AIR WITH THIS CARBON HEIST

    http://ajitvadakayil.blogspot.in/2011/01/murky-truths-of-inflation-and.html

    http://ajitvadakayil.blogspot.in/2011/02/worth-more-than-sum-total-of-entire.html

    capt ajit vadakayil
    ..

    ReplyDelete
  28. STOP PRESS :

    kancha ilaih SQUEAK nay shephard came on TV couple of years ago.

    he was cracking up from within-- his voice quivered with sheer grief when he cried--THESE HINDU GODS ARE SO VIOLENT, THEY ARE ALL THE TIME KILLING PEOPLE

    to this SQUEAK i must say " hindus gods are all cosmic allegories except vishnu avatars "

    stop moaning that Brahmins did NOT allow shudras to learn vedas – this would be as irresponsible as a brain surgeon allowing his nurse to do brain surgery on a holiday .. vedas went on the oral route for 300 centuries, without losing a syllable , before they were penned down 70 centuries ago ..

    CONDENSATION DOES NOT KILL EVAPORATION--THIS IS A CONCEPT MEANT FOR THE WISE--NOT IDIOTS.

    http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html
    devdutt pattanaik who does NOT understand sanatana dharama comes on TV serials aand denigrated hindusim.

    he thinks that hindu gods are mortals , and their vahanas ( vimanas ) animals and birds.

    see the way amish tripati converted shiva to be a tribal sex started mortal and the white man loved him for it.

    devdutt pattanaik's attitude towards hinduism can be gauged from the post below--

    read the part n blue italics- where shiva is hiding from nandi bull who is waiting in ambush to rape shiva anally . . . reciprocation if you please . .

    http://ajitvadakayil.blogspot.in/2014/01/nandi-bull-vahana-and-gatekeeper-of.html

    if he did the same in saudi arabia to islam he would have been beheaded on the streets within an hour.

    this blogsite asks TIMES OF INDIA e-newspaper to stop denigrating Hinduism daily vide its SPIRITUALITY COLUMN.

    devdutt pattanaik must know there is no heaven and hell in Hinduism.

    somebody asked me about old people-- even from kerala-- going to KASHI GHATS to die.

    well in olden days due to the saraswati river underground component, there was a MOBIUS COIL water flow at the ghats . people whose souls departs from this massive SCALAR FIELD gets a boost of ONE astral layer

    same with kailash mountain-- pandavas walked to mount kailash before they died.

    pyramid shaped mount kailash has an ORGONE FIELD due to the golden mean of 1.618 .

    http://ajitvadakayil.blogspot.in/2010/12/secrets-of-egyptian-pyramids-revealed.html

    THIS BLOGSITE WARNS JNU COMMIE PROFESSORS, NOT TO COOK UP FALSE STORIES ABOUT SANATANA DHARMA . .

    WE DONT WANT COMMIES TO SAVE INDIA..

    capt ajit vadakayil
    ..

    ReplyDelete
  29. Hello Mr Ajit,

    I have a related query regarding severe COPD.

    My mother had been diagnosed with Severe COPD & pulmonary hypertension in July. Now her O2 levels are going below 80. & Doctor has advised us to give 16 hours daily Oxygen therapy for 6 months to reduce heart pressures.

    What should we do? Install an oxygen machine at home or make her do pranayam.

    Thanks
    Vishal Bhagwani
    Nasik.

    ReplyDelete
    Replies
    1. hi v,

      Chronic Obstructive Pulmonary Disease (COPD) is an umbrella term used to describe progressive lung diseases including emphysema, chronic bronchitis, refractory (non-reversible) asthma, and some forms of bronchiectasis. This disease is characterized by increasing breathlessness.

      SMOKING IS THE MOST COMMON CAUSES. BLUE ASBESTOS FIBRE CAUSES COPD . SILICOSIS TOO.

      Every time you breathe in, air passes through your windpipe and into your bronchial tubes. In your lungs, these bronchial tubes branch off into thousands of smaller tubes called bronchioles. At the ends of the bronchioles are air sacs called alveoli. These air sacs are like little balloons. When you breathe in, they stretch and fill with air. When you breathe out, they shrink back down.

      In the walls of the air sacs are tiny blood vessels called capillaries. When the air sacs fill with air, oxygen goes into the capillaries to be carried through your blood stream to all parts of your body. At the same time, carbon dioxide (a waste material) passes out of the capillaries into the air sacs. Then you breathe it out.

      COPD causes the following changes in your lungs and airways:

      air sacs and airways lose their ability to stretch
      the walls of the air sacs are destroyed
      the walls of the airways become thickened and inflamed
      airways become clogged with mucus

      If you have COPD, you may have one or more of these changes in your lungs. These changes reduce the flow of air in and out of your lungs. This deprives your body of much-needed oxygen.

      Emphysema involves destruction of the lung tissue, specifically the alveoli.

      In chronic bronchitis, your airways become swollen and can be filled with mucus, which can make it hard for you to breathe.

      In emphysema, the air sacs (alveoli) in your lungs are damaged which can make it hard for you to breathe.

      People with COPD are at increased risk of developing heart disease, lung cancer and a variety of other conditions.

      https://www.youtube.com/watch?v=WziBGY1xwow

      Your lungs rely on the natural elasticity of the bronchial tubes and air sacs to force air out of your body. COPD causes them to lose their elasticity and overexpand, which leaves some air trapped in your lungs when you exhale.

      CONTINUED TO 2-

      Delete
    2. CONTINUED FROM 1-

      Symptoms may include any of the following:---
      Cough, with or without mucus
      Fatigue
      Many respiratory infections
      Shortness of breath (dyspnea) that gets worse with mild activity
      Trouble catching one's breath
      Wheezing
      Frequent respiratory infections
      Lack of energy
      Unintended weight loss (in later stages)
      Swelling in ankles, feet or legs

      Because the symptoms develop slowly, some people may not know that they have COPD.

      COPD is commonly misdiagnosed — former smokers may sometimes be told they have COPD, when in reality they may have simple deconditioning or another less common lung condition. Likewise, many people who have COPD may not be diagnosed until the disease is advanced and interventions are less effective.

      There are two main forms of COPD:---
      Chronic bronchitis, which involves a long-term cough with mucus.
      In chronic bronchitis, the airways that carry air to the lungs get inflamed and make a lot of mucus. This can narrow or block the airways, making it hard for you to breathe.

      Emphysema, which involves damage to the lungs over time.In a healthy person, the tiny air sacs in the lungs are like balloons. As you breathe in and out, they get bigger and smaller to move air through your lungs. But with emphysema, these air sacs are damaged and lose their stretch. Less air gets in and out of the lungs, which makes you feel short of breath.
      .
      Most people with COPD have a combination of both conditions.

      Oxygen therapy can improve quality of life and is the only COPD therapy proven to extend life as pr western medicine

      PRANAYAMA ( NITRIC OXIDE GENERATION ) AND SURYA NAMASKAR IS CRITICAL

      Spirometry can detect COPD even before you have symptoms of the disease. It can also be used to track the progression of disease and to monitor how well treatment is working. Spirometry often includes measurement of the effect of bronchodilator administration.

      Respiratory infections, such as acute bronchitis, pneumonia and influenza, can aggravate COPD symptoms. Antibiotics help treat acute exacerbations, but they aren't recommended for prevention. Antibiotic azithromycin prevents exacerbations.

      Use an air filter in your home.

      Bronchodilators are used for COPD treatment because they open up the airway tubes and allow air to more freely pass in and out of the lung tissue. There are both short-term (several hours) and long-term (12 or more hours) types of bronchodilators.

      A CT scan will usually show signs of COPD.

      Medicines used to treat COPD include:--
      Inhalers (bronchodilators) to help open the airways
      Inhaled or oral steroids to reduce lung inflammation
      Anti-inflammatory drugs to reduce swelling in the airways
      Certain long-term antibiotics

      In severe cases or during flare-ups, you may need to receive:--
      Steroids by mouth or through a vein (intravenously)
      Bronchodilators through a nebulizer
      Oxygen therapy
      Assistance from a machine to help breathing by using a mask, BiPAP, or through the use of an endotracheal tube
      Your doctor may prescribe antibiotics during symptom flare-ups, because an infection can make COPD worse.

      COPD PATIENTS MUST DO DEEP DIAPGRAMATIC BREATHING AND NEVER HYPERVENTILATION

      Capt ajit vadakayil
      ..

      Delete

  30. Razor Skidrow
    October 20, 2016 at 12:22 PM
    AJIT VADAKAYIL YOUR BLOG IS MENTIONED IN A PUBLISHED BOOK BY A PHD historian Kim Henry Veltman :

    https://books.google.co.nz/books?id=J1fHBgAAQBAJ&pg=PA62&dq=ajit+vadakayil&hl=en&sa=X&ved=0ahUKEwjHlNK64ujPAhXG3YMKHY-9AcwQ6AEIRzAH#v=onepage&q=ajit%20&f=false

    9 and 11: Day of Fate. Day of Destiny. Day that Changed the World

    Wow, congragulations. That moment when people use "blogs" as a source.

    ReplyDelete
    Replies
    ###################
    Capt. Ajit Vadakayil
    October 20, 2016 at 2:35 PM
    hi rs,

    I HAVE SPOTTED THE GIRL

    MENTAL COPULATION HAS JUST STARTED A FEW DAYS GO

    PETTING/ HUMPING/ EJACULATION AND PILLOW TALK IS FAR FAR AWAY

    MY REVELATIONS ARE JUST 22.45%

    IS THERE ANY WRITER UNDER THE SUN--PAST OR PRESENT WHO HAS COVERED THE RANGE OF TOPICS AS I HAVE DONE?

    MANGY JEWS WITH ONE MEASLY REVELATION OR INNOVATION AND HAVE BECOME WORLD HEROES

    THIS BLOGSITE HAS MADE MORE THAN TEN THOUSAND REVELATIONS IN THE INVENTION/ DISCOVERY PLANE.

    ALL IT IF WILL BEAR OUT TO BE TRUE SOONER THAN LATER

    I DO NOT NEED SUPPORT OR SHORE UP FROM ANY MORTAL SOUL

    THERE IS NO HISTORIAN ON THIS PLANET WHO HAS A HANDLE ON HISTORY BEFORE 1500 AD

    A LOT OF STUFF COMES FROM MY GENOME

    WHEN A MAN MADE A SUPER COMPUTER OR SENT A ROCKET TO MARS--YOU MUST REMEMBER THAT NOTHING IS HIS OWN

    THE MAN WHO DID IT ( SAY TESLA ) IS JUST A BALL OF ENERGY INSIDE A HUMAN CARCASS

    SOULS GET MOKSHA AND GIVE FEEDBACK TO THE MOTHER FIELD OF BRAHMAN

    BRAHMAN KNOWS EVERYTHING

    WHEN THE FEED BACK LOOP IS SATURATED AND PRESENT KNOWLEDGE BECOMES PAST KNOWLEDGE THE LOOP GETS STAGNANT

    CHANGE IS THE ONLY CONSTANT --STAGNANCY DOES NOT FOLLOW THE LAWS OF THE COSMOS

    AT THAT TIME BRAHMA BREATHES IN

    PRALAYA DISSOLVES THE COSMOS

    LIFE BEGINS ALL OVER AGAIN

    AT SOME STAGE VISHNU COMES AS MATSYA AVATAR TO SET UP THE GOLDEN MEAN

    LATER AT ANOTHER STAGE VISHNU COMES AS VARAHA TO TILT THE EARTHs AXIS , INTRODUCE SEASONS FOR FLORA AND FAUNA -- AND INTRODUCE 108 -THE NUMBER WHICH CONTAINS SRI YANTRA AND THE THEORY OF EVERYTHING.

    VEDAS WILL THEN BE PICKED OFF AKASHIK RECORDS BY SUPERMEN MAHARISHIS ALL OVER AGAIN.

    WELL WELL

    WHAT DO YOU KNOW !

    http://ajitvadakayil.blogspot.in/2014/07/nasadiya-sukta-rig-veda-5000-bc.html

    capt ajit vadakayil
    ..

    Delete
    ####################
    Nitesh PoKHREL
    October 20, 2016 at 2:55 PM
    our capt is a legend! Truth shall prevail!

    Delete
    ################333
    Nicolas C.D
    October 21, 2016 at 11:38 AM
    Ajit Ji

    In fact the chronology in use was crafted arround that time by the Jesuit Julius Justus Scalliger to match the Bible(Newton had issues with this, then the russian communists). You are absolutely right. Any thoughts on the accuracy of carbon dating?

    All my best

    Nicolas

    Delete
    ############################
    Capt. Ajit Vadakayil
    October 21, 2016 at 1:00 PM
    hi ncd,

    ROTHSCHILDs JEW ARCHAEOLOGISTS ALWAYS LIED WHEN IT CAME TO CARBON DATING

    THEY PLANTED ARTIFACTS ( BY TRANSIT BEARINGS/ TRIANGULATION ) AND THEM AFTER A COUPLE OF DECADES DUG IT UP IN THE PRESENCE OF WITNESSES.

    JEWS ALWAYS KNEW WHERE TO DIG AND HOW DEEP IN PALESTINE.

    WHEN SIR WILLIAM FLINDERS PETRIE DIES THEY FOUND A SECRET ROOM BEHIND HIS BOOKSHELF WHERE ARTIFICIALLY AGES ARTIFACTS WERE YET TO BE BURIED ( AND LATER EXHUMED ). THIS INCLUDED AN ALIEN.

    http://ajitvadakayil.blogspot.in/2016/04/apollonius-or-jesus-christ-who-is-real_14.html

    THIS BLOGSITE WILL EXPOSE ALL LIES OF JEWISH HISTORIANS .

    MOSES LED THE JEWS OUT OF EGYPT--LOOKS LIKE ALL WERE BLIND --NOBODY SAW THE PYRAMIDS AND SPHINX.

    ENOUGH OF CONVERTING SUNRISE TO SUNSET

    WHEN DONALD TRUMP EXPOSED THE LIES OF CROOKED HILLARY CLINTON , ALL BOOOO. THIS BOOO IS AIMED AT HILLARY --NOT TRUMP.

    YET EVERY PRESSITUTE WILL WRITE THAT THE BOOO WAS AIMED AT TRUMP.

    OH YEAH ?

    capt ajit vadakayil
    ..

    ReplyDelete
  31. Aiswarya r
    October 25, 2016 at 3:19 PM

    Captainji,

    Is Polyphasic sleeping good?

    http://www.sciencealert.com/these-are-the-sleeping-habits-of-the-rich-the-powerful-and-the-genius

    Please answer, Thank you.

    ReplyDelete
    Replies
    ########################

    Capt. Ajit Vadakayil
    October 25, 2016 at 8:26 PM

    http://ajitvadakayil.blogspot.in/2013/02/the-dreamer-and-rem-sleep-witness-and.html

    6200 YEAR OLD AYURVEDA WANTS TO TO HAVE REM SLEEP.

    REM SLEEP IS PART OF THE ANCIENT HINDU SYMBOL OM -- THIS IS HOW IMPORTANT IT IS.

    Biphasic sleep (or bimodal or bifurcated sleep) is the practice of sleeping during two periods over 24 hours, while polyphasic sleep refers to sleeping multiple times - usually more than two

    POLYPHASIC SLEEP DEPRIVES YOU OF REM SLEEP AND MAKE YOU A CHOOT- NAY -DRIPPING CUNT.

    Jew Rothschild used his agent Jew J. S. Szymanski to make people lose REM sleep

    Polyphasic sleeping, a term conjured by psychologist J. S. Szymanski, is quite self explanatory when you break down the word: 'poly' meaning 'many' (hence 'polygon' – a many sided shape) and 'phasic' meaning 'phases'. In other words, polyphasic sleep means sleeping in lots of shorter bursts as opposed to one long go.

    I CAN WRITE A THESIS ON REM SLEEP

    IT IS A FOUL LIE THAT NIKOLA TESLA DID NOT HAVE REM SLEEP. HE WAS AN INVENTOR FAVORED BY GOD .

    TESLA WAS JUST A MEDIUM OF BRAHMAN .

    I WEAR A Xi BAND 2 REM SLEEP MONITOR ON MY WRIST -AND I EXPERIMENT DAILY

    http://www.pcadvisor.co.uk/review/activity-trackers/xiaomi-mi-band-review-best-value-fitness-band-offers-top-battery-life-3598126/

    I SHOULD BE CHARGING THESE PEOPLE FOR PHUKKAT KA PUBLICITY -- MY BLOG REACHES MORE PEOPLE THAN THEIR MANGY ADVERTISEMENTS CAN EVER REACH

    http://ajitvadakayil.blogspot.in/2013/01/understanding-jet-lag-and-managing-it.html

    Polyphasic sleep KILLS one’s creativity. Ayurveda says clearly that there is no brain control mechanism that would make it possible to adapt to the "multiple naps" system. Body will always tend to consolidate sleep into at least one solid block when stress free. I know I was deprived of REM sleep during my last month on board ships and I tended to increase my weight every single day.


    Polyphasic sleepers disrupt their circadian rhythms, will eventually cause them to suffer the same negative effects as those with other forms of sleep deprivation and circadian rhythm sleep disorders, such as decreased mental and physical ability, increased stress and anxiety, and a weakened immune system.

    THIS IS A CONSPIRACY OF THE NEW WORLD ORDER .

    capt ajit vadakayil
    ..

    ReplyDelete
  32. WHEN I SAID SAMUDRA MANTHAN WAS DONE BY 54 DEVAS AND 54 DANAVAS ( VISHNUs KURMA AVATAR LEGEND )

    SOMEONE ASKED ME

    WHY DANAVA --WHY NOT ASURA

    ASURA AND DANAVA ARE SAME

    DIWALI IS VICTORY OF DEVAS OVER DANAVAS --THAT IS WHY WE DO NOT CELEBRATE DIWALI IN KERALA WHILE REST OF INDIA DOES .

    http://ajitvadakayil.blogspot.in/2011/09/why-kerala-does-not-celebrate-diwali-or.html

    BUT WE IN KERALA , THE LAND OF AYURVEDA CELEBRATE THE DANTERAS

    I AM A DANAVAN

    THAT DOES NOT MEAN I DO NOT LOVE THE VISHNU AVATARS--WE PRAY TO VISHNU AVATARS RAMA, KRISHNA , AYYAPPA

    THE PRODUCT OF SAMUDRA WAS THE GOD OF AYURVEDA DANAVAN-TARI

    IN THE GREAT EFFORT OF OCEAN CHURNING, THE DANAVAS GOT THE SHORT END OF THE STICK

    THE DANAVAS ( ASURAS ) WERE FOOLED INTO HOLDING THE HEAD SIDE OF VASUKI THE FIRE BREATHING OUT SNAKE, WHILE DEVAS HELD THE TAIL --AND ALL 54 DANAVAS GOT BURNT VERY BADLY .

    YET DEVAS DID NOT HONOUR THE DEAL--THEY SCOOTED WITH THE AMRIT.

    NOW MIND YOU--THIS IS AN ALLEGORY ON MACRO AND MICRO SCALE

    IT IS ALL ABOUT THE NUMBER DIVINE NUMBER 108 ( OM ) -- THE CONCH WHICH DHANVANTARI HELD ( GOLDEN MEAN --GOLDEN SPIRAL-- CONSCIOUSNESS FIELD )

    http://ajitvadakayil.blogspot.in/2013/03/secrets-of-shankh-or-conch-product-of.html

    WE GAVE FIBONACCI RATIO TO THIS PLANET--THE ITALIAN WAS A THIEF

    http://ajitvadakayil.blogspot.in/2010/12/perfect-six-pack-capt-ajit-vadakayil.html

    THIS IS WHY, WHEN I VISTED PYRAMIDS OF EGYPT, I DECLARED--THE ARCHITECT IS FROM INDIA . BECAUSE GOLDEN MEAN AND RATIO IS ALL OVER THE PLACE. THE PRODUCT OF SAMUDRA MANTHAN

    http://ajitvadakayil.blogspot.com/2016/10/eight-sided-pyramid-of-giza-egypt.html

    BY THE WAY MY VAASTU POST ( SANATANA DHARMA PART 68 ) IS INCOMPLETE . I AM ENGAGED WITH US ELECTIONS . THESE NINE DAYS ARE CRUCIAL .

    IT IS ALL ABOUT REMOVING THE VICE GRIP OF KOSHER BIG BROTHER ON THE PLANET. MORONS WILL NOT UNDERSTAND WHAT THIS MEANS

    THERE IS NO SUPERSTITION IN SANATANA DHARMA.

    IDIOTS WHO KNOW SANSKRIT LANGUAGE CANNOT UNDERSTAND THE GLORY OF HINDUISM .

    YOU CANNOT UNDERSTAND SANATANA DHARMA IF YOU DONT UNDERSTAND QUANTUM PHYSICS.

    http://ajitvadakayil.blogspot.in/2013/05/vishnu-first-matysa-avatar-dolphins-and.html

    http://ajitvadakayil.blogspot.in/2013/05/vishnu-avatar-varaha-boar-fixing-planet.html

    WITH VAMANA AVATAR INDIA SPREAD ITS INFLUENCE TO THE FAR END OF THE WORLD

    http://ajitvadakayil.blogspot.in/2012/07/maya-inca-aztec-civilizations-decoded.html

    WITH AYYAPPA AVATAR INDIA SPREAD ITS INFLUENCE TO EGYPT AND MIDDLE EAST

    http://ajitvadakayil.blogspot.in/2011/08/imhotep-patron-saint-of-freemasons-capt.html

    I HAVE JUST REVEALED 5%

    WELL, WELL --WHAT DO YOU KNOW !

    capt ajit vadakayil
    ..

    ReplyDelete