SANATANA DHARMA , HINDUISM EXHUMED AND RESURRECTED, PART 58 - CAPT AJIT VADAKAYIL

THIS POST IS CONTINUED FROM PART 57, BELOW-

http://ajitvadakayil.blogspot.in/2016/07/sanatana-dharma-hinduism-exhumed-and_29.html

NONE OF THE SO CALLED ANCIENT CIVILIZATIONS OF THE PLANET HAVE LEFT BEHIND ANYTHING OF CEREBRAL VALUE IN WRITING-- ABSOLUTELY  NOTHING !!     

80% OF OUR VEDAS ( SAMHITAS/ BRAHMANAS/ ARANYAKAS/ UPANSIHADS) HAVE BEEN STOLEN / DESTROYED BY THE WHITE INVADER.    

THE JEALOUS WHITE MAN  POST DATED OUR ANCIENT WORKS PENNED DOWN IN 5000 BC,   TO SUIT THEIR UNDERSTANDING OF BIG BANG DATED AT A RIDICULOUS 4004 BC.    

IN THIS INTERNET AGE, IT IS PAY BACK TIME !   

THE WORLD SHALL KNOW THE GLORY OF ANCIENT INDIA  !! 

CHECK OUT THE SOUND OF  PATANJALIs YOGA SUTRAS PENNED DOWN 7000 YEARS AGO, WHEN THE REST OF THE WORLD WERE RUNNING AROUND NAKED DOING GRUNT GRUNT

http://ajitvadakayil.blogspot.in/2015/01/yoga-only-complete-exercise.html

http://ajitvadakayil.blogspot.in/2015/01/yoga-only-complete-exercise-part-2-capt.html

CHAPTER I-  SAMADHI PADA-   CONTEMPLATION

atha yoganushasanam

yogashchittavrittinirodhah

tada drashtuh svaroope avasthanam

vrittisaroopyam itaratra

vrittayah pangchatayyah klishta aklishtah

pramannaviparyayavikalpanidrasmritayah

pratyakshanumanagamah pramanani

viparyayo mithyajnanam atadroopapratishtham

shabdajnaananupati vastushoonyo vikalpah

abhavapratyayalambana vrittirnidra

anubhootavishayasanpramoshah smritih

abhyasavairagyabhyan tannirodhah

tatra sthitau yatno abhyasah

sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih

drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam

tatparan purushakhyatergunnavaitrishnyam

vitarkavicharanandasmitaroopanugamatsanprajnatah

viramapratyayabhyasapoorvah sanskarashesho anyah

bhavapratyayo videhaprakritilayanam

shraddhaviryasmritisamadhiprajnapoorvaka itaresham

tivrasanveganam aasannah

mridumadhyadhimatratvat tatopi visheshah

eeshvarapranidhanad va

kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah

tatra niratishayan sarvajntvabijam

sa poorvesham api guruh kalenanavachchhedat

tasya vachakah prannavah

tajjapastadarthabhavanam

tatah pratyakchetanadhigamopyantarayabhavashch

vyadhistyanasanshayapramadalasyaviratibhrantidarshanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah

duhkhadaurmanasyanggamejayatvashvasaprashvaavikshepasahabhuvah

tatpratishedhartham ekatattvabhyasah

maitreekarunamuditopekshanansukhaduhkhapunyapunyavishayananbhavanatashchittaprasadanam

prachchhardanavidharanabhyan va prannasya

vishayavati va pravrittirutpanna manasah sthitinibandhini

vishoka va jyotishmati

vitaragavishayan va chittam

svapnanidrajnanalambanan va

yathabhimatadhyanad va

paramanu paramamahattvantosya vashikarah

ksheennavritterabhijatasyevmanergrahitrigrahannagrahyeshutatsthatadangjanatasamapattih

tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih

smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka

etayaiva savichara nirvichara cha sookshmavishaya vyakhyata

sookshmavishayatvan chalinggaparyavasanam

ta eva sabijah samadhih

nirvicharavaisharadye adhyatmaprasadah

rtanbhara tatr prajna

shrutanumanaprajnabhyam anyavishayaa vishesharthatvat

tajjah sanskaro nyasanskarapratibandhi

tasyapi nirodhe sarvanirodhannirbijah samadhih

CHAPTER II - SADHANA PADA-- PRACTISE

tapahsvadhyayeshvarapranidhanani kriyayogah

samadhibhavanarthah kleshatanookaranarthashch

avidyasmitaragadveshabhiniveshah kleshaah

avidya kshetram uttareshanprasuptatanuvichchhinnodaranam

anityashuchiduhkhanatmasunityashuchisukhatmakhyatiravidya

drigdarshanashaktyorekatmatevasmita

sukhanushayi raagah

duhkhanushayi dveshah

svarasavahi vidushopi tatharoodho bhiniveshah

te pratiprasavaheyah sookshmah

dhyanaheyastadvrittayah

kleshamoolah karmashayodrishtadrishtajanmavedaniyah

sati moole tadvipako jatyayurbhogah

te hladaparitapafalah punyapunyahetutvat

parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah

heyan duhkham anagatam

drashtridrishyayoh sanyogo heyahetuh

prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam

visheshavisheshalinggamatralinggani gunnaparvani

drashta drishimatrah shuddhopi pratyayanupashyah

tadarth eva drishyasyatma

kritarthan prati nashtam apyanashtantadanyasadharannatvat

svasvamishaktyoh svaroopopalabdhihetuh sanyogah

tasya heturavidya

tadabhavat sanyogabhavo hanan taddrisheh kaivalyam

vivekakhyatiraviplava hanopayah

tasya saptadhaa prantabhoomih prajna

yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh

yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani

ahinsasatyasteyabrahmacharyaparigraha yamah

jatideshakalasamayanavachchhinnahsarvabhauma mahavratam

shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah

vitarkabadhane pratipakshabhavanam

vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam

ahimsapratishthayam tatsannidhau vairatyagah

satyapratishthayam kriyafalashrayatvam

asteyapratishthayam sarvaratnopasthanam

brahmacharyapratishthayam viryalabhah

aparigrahasthairye janmakathantasanbodhah

shauchat svanggajugupsa parairasansargah

sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha

santoshad anuttamah sukhalabhah

kayendriyasiddhirashuddhikshayat tapasah

svadhyayad ishtadevatasanprayogah

samadhisiddhirishvarapranidhanat

sthirasukham aasanam

prayatnashaithilyanantasamapattibhyam

tato dvandvanabhighatah

tasmin sati shvasaprashvasayorgativichchhedah pranayamah

bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah

bahyabhyantaravishayakshepi chaturthah

dharanasu ch yojnata manasah

svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah

CHAPTER III – VIBHOOTI PADA - MANIFESTATION

deshabandhashchittasya dharana

tatra pratyayaikatanata dhyanam

tad evarthamatranirbhasan svaroopashoonyam iva samadhih

trayam ekatra sanyamah

tajjayat prajnaalokah

tasya bhoomishu viniyogah

trayam antaranggan poorvebhyah

tad api bahiranggan nirbijasy

vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah

tasya prashantavahita sanskarat

sarvarthataikagratayoh

kshayodayau chittasyasamadhiparinamah

tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah

etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah

shantoditavyapadeshyadharmanupati dharmi

kramanyatvan parinamanyatve hetuh

parinamatrayasanyamadatitanagatajnanam

shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam

sanskarasakshatkaranat poorvajatijnanam

pratyayasy parachittajnanam

na cha tat salambanan,tasyavishayibhootatvat

kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam

etena shabdadyantardhanamuktam

sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,

arishtebhyo va

maitryadishu balani

baleshu hastibaladini

pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam

bhuvanajnanan soorye sanyamat

chandre taravyoohajnanam

dhruve tadgatijnanam

nabhichakre kayavyoohajnanam

kanthakoope kshutpipasanivrittih

koormanadyan sthairyam

moordhajyotishi siddhadarshanam

pratibhad va sarvam

hridaye chittasanvit

sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat

svarthasanyamat purushajnanam

tatah pratibhashravannavedanadarshasvadavarta jayante

te samadhavupasargaa vyutthane siddhayah

bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah

udanajayajjalapangkakantakadishvasangg utkrantishch

samanajayat prajvalanam

shrotrakashayoh sanbandhasanyamad divyan shrotram

kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam

bahirakalpita vrittirmahavideha tatahprakashavarannakshayah

sthoolasvaroopasookshmanvayarthavattvasamyamadbhootajayah

tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch

roopalavanyabalavajrasanhananatvani kayasanpat

grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah

tato manojavitvan vikarannabhavah pradhanajayashch

sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha

tadvairajnadapi doshabijakshaye kaivalyam

sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat

kshannatatkramayoh sanyamadavivekajam jnanam

jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih

tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam

sattvapurushayoh shuddhisamye kaivalyam iti

CHAPTER IV--  KAIVALYA PADA --  LIBERATION

janmaushadhimantratapahsamadhijah siddhayah

jatyantaraparinamah prakrityapoorat

nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat

nirmannachittanyasmitamatrat

pravrittibhede prayojakam chittam ekam anekesham

tatra dhyanajam anashayam

karmashuklakrishnnam yoginah trividham itaresham

tatastadvipakanugunanam evabhivyaktirvasananam

jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat

tasam anaditvam chashisho nityatvat

hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah

atitanagatan svaroopatostyadhvabhedad

te vyaktasookshma gunatmanah

parinamaikatvad vastutattvam

vastusamye chittabhedat tayorvibhaktah panthah

taduparagapekshatvat chittasya vastu jnatajnatam

sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat

na tat svabhasandrishyatvat

ekasamaye chobhayanavadharannam

chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha

chiterapratisankramayastadakarapattausvabuddhisanvedanam

drashtridrishyoparaktan chittan sarvartham

tadasankhyeyavasanachitram api pararthan sanhatyakaritvat

visheshadarshin aatmabhavabhavanavinivrittih

tada vivekanimnan kaivalyapragbharan chittam

tachchhidreshu pratyayantarani sanskarebhyah

hanam esham kleshavaduktam

prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih

tatah kleshakarmanivrittih

tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam

tatah kritarthanan parinamakramapari samaptirgunanam

kshannapratiyogi parinamaparantanigrarhyah kramah

purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti

2.46- -  sthirasukham aasanam

Asana is perfect firmness of body, steadiness of intelligence and benevolence of spirit. 

The definition of asana is stated as follows - whatever asana is performed, it should be done with a feeling of firmness, steadiness and endurance in the body; goodwill in the intelligence of the head, and awareness and delight in the intelligence of the heart. This is how each asana should be understood, practised and experienced. Performance of the asana should be nutrifying and illuminative. One of the major aims of yoga is to drive the lymph fluid. Main stream science and medicine has NOT caught up yet with the Lymphatic system. A good Lymph doctor can have one look at you, and tell you what is wrong with you. This science is so exact. The lymphatic system in your body is a series of connected nodes, ducts and organs that play a vital part in your immune system. The human arteries are like a two-lane highway bringing nutrients, oxygen and fluid to the body part. The vein is a one-lane highway taking away the used blood, and the lymphatic channels are the other one-lane highway draining away the lymph fluid. Two lanes in together, but two out lanes separate out. Blood is responsible for collecting and distributing oxygen, nutrients and hormones to the entire body where lymph is responsible for collecting and removing waste products left behind in the tissues. Plasma leaks out of the capillaries to surround and bathe the body tissues. This then drains into the lymph vessels. The circulatory system processes an average of 20 liters of blood per day.  Roughly 17 liters per day of that gets reabsorbed directly into the blood vessels. The primary function of the lymph system is to provide an accessory route for these excess 3 liters per day to get returned to the blood. So colourless lymph is essentially recycled blood plasma. The biggest lymph vessel is the thoracic duct, which empties back into the blood circulation.  At the cellular level, the lymphatic system is a pathway through which fluid flows from the intercellular spaces into the blood. The lymphatic system has vessels just like our circulatory system, but does not have a pump like the heart for the circulatory system . In order to clear the “lymph” (the clear extracellular fluid that is collected by the lymphatic vessels and filtered by the lymph nodes), the lymphatic system must be pumped manually. Lymph is a clear fluid that travels through your body's arteries, circulates through your tissues to cleanse them and keep them firm, and then drains away through the separate lymphatic system. Lymph nodes are the filters along the lymphatic system.  Their job is to filter out and trap bacteria, viruses, cancer cells, and other unwanted substances, and to make sure they are safely eliminated from the body. Each cell is nourished by the nutrients, oxygen and proteins that flow across the walls of capillaries into the interstitial fluid. There is a dynamic balance between the forces that help those nutrients to first exit the capillaries, and then get reabsorbed back into the blood stream. Since there is no pump, the lymph movement relies on contraction of smooth muscle tissue lining the walls of lymph vessels. Movement of skeletal muscles is also important for driving lymph along the systems network of vessels to lymph nodes and from these to lymph ducts where the lymph tissue joins cardiovascular circulation. This is what the scientifically formulated Yoga positions do. 6000 years ago, Ayurveda and Yoga  realized that many lymph nodes are situated near the region around the joints. Humans have approximately 500-700 lymph nodes distributed throughout the body, with clusters found in the underarms, groin, neck, chest, and abdomen. All lymph vessels lead to lymph nodes. Lymph nodes can be as small as the head of a pin, or as big as an olive . Half of the lymph nodes in the body, are  located in the abdomen, and many are in the neck. The movements of the limbs help to act as a pump to move the lymph through the system. They are located in clusters around the knee, groin, elbows, shoulders and neck. Lymph nodes are also found in the central abdominal and chest area to assist with lymph drainage around the vital organs. Every Yoga movement take this into account. This is why Yoga must not be self inflicted.  Because the lymph doesn't have a heart to pump it so good circulation of the lymphatic system depends on getting proper stretching exercise and yogic inverted postures which use gravity. Approximately 70% are superficial lymphatic capillaries located  just under, the skin. The remaining 30%, which are known as deep lymphatic capillaries, surround most of the body’s organs. The deep ones can be stimulated only by Yoga. Like veins, the lymphatic vessels, which are known as lymphangions, have one-way valves to prevent any backward flow. Yogic asanas to aid lymph flow includes neck rotation, shoulder shrugs, ankle pumps, leg slides, shoulder blade squeezes etc. Yoga diaphragmatic breathing and many yoga positions open up the chest cavity, while poses like shoulder stands, enlist gravity to help lymph fluid get where it is supposed to go. Suryanamaskar for deep Lymph node drainage.  Surya namaskar can increase lymph flow 20 fold.  Two-thirds of the lymph is produces in the liver and intestines. Because the lymphatic system is a closed pressure system and has one-way valves that keep lymph moving towards the heart, when one turns upside down like in Shirshasan , the entire lymphatic system is stimulated, thus strengthening your immune system. Lymph fluid is relieved from the legs and ankles and with regular practice prevents the buildup of fluid in the legs and feet.  Usually gravity is pulling us down and compressing our bodies, yet when we do inversions this process is completely reversed. So instead of working against us, gravity is working for us by decompressing our bodies and reversing the flow of the lymphatic system, which does NOT have a pump. Yoga asanasas help to shift Lymph fluids around your body in ways that you would not ordinarily be able to achieve in daily life . Kalari marma knock out points can permanently damage certain NON-RETURN valves of the lymphatic system, when means the enemy goes home bloats up and dies. 

Some have taken this sutra to understand that any comfortable posture is suitable. If that were so, these would be asanas of pleasure (bhogasanas) not yogasanas. This sutra defines the perfected asana. From the very first sutra Patanjali calls for the highest quality of attention to perfection. This discipline and attention must be applied for the practice of every asana, to permeate to its very depths in the remotest parts of the body. Even the meditational asana has to be cultivated by the fibres, cells, joints and muscles in cooperation with the mind.  Some divide asanas into those, which cultivate the body and those, which are used in meditation. But in any asana the body has to be toned and the mind tuned so that one can stay longer with a firm body and a serene mind. Asanas should be performed without creating antagonism in the muscle spindles or the skin cells. Space must be created between muscle and skin so that the skin receives the actions of the muscles, joints and ligaments. The skin then sends messages to the brain, mind and intelligence, which judge the appropriateness of those actions. In this way, the principles of yama and niyama are involved and action and reflection harmonise. In addition the practice of a variety of asanas clear the nervous system, causes the energy to flow in the system without impediment and guarantees an even distribution of that energy during pranayama.  Usually the mind is closer to the body and to the organs of action and perception compared to the soul. As asanas are refined, they automatically become meditative as the intelligence is made to interpenetrate towards the core of being.   Each asana has five functions to perform. These include - conative, cognitive, mental, intellectual and spiritual. Conative action is the exertion of the organs of action. Cognitive action is the perception of the results of that action. When the two are melded together, the discriminative faculty of the mind acts to guide the organs of action and perception to perform the asanas more perfectly; the rhythmic flow of energy and awareness is experienced evenly and without interruption, both centripetally and centrifugally throughout the channels of the body. A pure state of joy is experienced in the cells and the mind. The body, mind and soul are one. This is the manifestation of dharana and dhyana in the practice of an asana.  Patanjali's explanation of dharana and dhyana in sutras in 1-2 brilliantly describes the exact performance of an asana. He says, 'the focusing of attention on a chosen point or area within the body as well as outside is concentration (dharana). Maintaining this intensity of awareness leads from one-pointed attention to non-specific attentiveness'. When the attentive awareness between the consciousness of the practician and his practice is unbroken, it becomes dhyana. In 2.48, when Patanjali says that the pairs of opposites do not exist in the correct performance of an asana, he clearly implies the involvement of dharana and dhyana.The science and the practice of Hatha Yoga evolved to allow us to develop the requisite strength, flexibility, endurance and balance so we could stay in the meditative posture for a long time. The stiffness and tension in the body is caused by physical (chemical) and mental toxins that get deposited in the body. Improper diet and lack of proper exercise is the main cause for the deposit of toxins in the body. Hatha Yoga practices include a variety of asanas (physical postures), pranayama (breathing practices), cleansing routines, and meditation to make the system strong, flexible and free of toxins. Hatha Yoga also provides guidelines for the proper diet that should be followed by the yoga practitioner. A regular practice of these yoga techniques will help develop the steady and comfortable posture that is given as the very definition of asana in this sutra.The physical aspect of what is called yoga in recent years, the asanas, has been much popularized in the West due to the vast amount of benefits. Physically, the practice of asanas is considered to:-improve flexibility, improve strength,improve balance, reduce stress and anxiety, reduce symptoms of lower back pain, be beneficial for asthma and chronic obstructive pulmonary disease , increase energy and decrease fatigue, shorten labor and improve birth outcomes, improve physical health and quality of life measures in the elderly, improve diabetes management, reduce sleep disturbances, reduce hypertension, improve blood/ lymph  circulation, reduce weight etc.. The emphasis on the physical benefits of yoga, attributed to practice of the asanas, has de-emphasized the other traditional purposes of yoga which are to facilitate the flow of prana (vital energy) and to aid in balancing the koshas (sheaths) of the physical and metaphysical body. In 2007, a CHOOT bong named Bikram Choudhury, tried to patent yoga at the US patent office  The govt of India  shot his mann ke tammanna down along with his misti dohi , rosogolla and machcher jhol. In 2008, to clearly show that all asanas are public knowledge and therefore not patentable, the government of India formed a team of yoga gurus, government officials, and 200 scientists from the Council of Scientific and Industrial Research (CSIR) to register all known asanas in a public database. The team collected asanas from 35 ancient texts including the Hindu epics, the Mahabharata, the Bhagwad Gita, and Patanjali's Yoga Sutras and as of 2010, has identified 900 asanas for the database which was named the Traditional Knowledge Digital Library and made available to patent examiners. Yoga is a fried to those who embrace it in sincerity and totality. The lazy body becomes active , vibrant and healthy. Patanjali's 196 sutras cover all aspects of life, beginning with a prescribes code of conduct, and ending with man's vision of his true self. The process of yoga guides the yogi towards observation of his inner self. If dharma is the seed of yoga, kaivalya ( liberation ) is its fruit.The different postures or asanas include:- Lying postures, Sitting postures, Standing postures, Inverted, or upside down postures. Yoga uses gravity to its potential to involve every muscle, ligament and sinew of the human body. A yogi’s body is firm , strong and supple. Yoga improves your endurance, especially the more athletic forms of yoga such as ashtanga yoga. Yoga is an excellent weight-bearing exercise that can improve your bone density. This is particularly beneficial for women approaching menopause, since yoga can help ward off osteoporosis, or thinning of the bone. Yoga has been used to help treat a wide variety of emotional and mental disorders, including acute anxiety, depression, mood swings, criminal behavior and homosexuality. Even children can benefit from yoga. Those with attention deficit disorder and hyperactivity can learn to relax and get control by using yoga breathing and yoga asanas. Because yoga is a form of meditation, it results in a sense of inner peace and purpose, which has far-reaching health benefits. Yoga has been used to help heal victims of torture or other trauma. Yoga can help fight fatigue and maintain your energy throughout the day.Yoga is an effective treatment for a variety of autoimmune diseases. Yoga has NO barriers. It does NOT matter how old or young you are. It does NOT matter of you are a supreme endurance athlete or a fat couch potato.   The body uses its own weight.  The idea is to explore your limits,  not strive for some pretzel-like perfection.  Yoga does ISOMETRIC exercise - without need of any equipment- by using body weight alone . Isometric exercise gives brute strength -- Yoga was the first to introduce isometric exercise to this planet  . Yoga also includes ISOTONIC exercise also so that contractile proteins are addressed. Isometric and isotonic exercises both build muscle.  The difference is that isotonic exercises involve contracting muscles while moving the joints around.  Isometric exercises involve contracting the muscles while keeping the joints still.  You can find examples of both in yoga.  Each of the yoga poses is built to reinforce the muscles around the spine,  which is the core from which everything else operates. When the core is working properly, posture is improved, thus alleviating back, shoulder and neck pain. Yoga asanas stretch and hold-  it causes  muscles to lengthen,  which gives the body a longer, leaner look.  Muscles are challenged as the mind and body have to work together simultaneously to hold a position or continue a succession without giving up.  Breathing, posing, moving and increasing flexibility happen all together at one time, which solicits a new level of discipline in your mind and body. sometric exercises are one of the best ways to build core strength.  Isometric, stemming from the words “same” and “length,” simply translates to holding one position without moving.  Power yoga uses isometric exercises along with other postures that are designed to make the core and back stronger. Flexibility and balance stem from your core, so it is very important to train this area of the body. An isometric exercise involves static contraction of a muscle without any visible movement in the angle of the joint.  The length of the muscle and the angle of the joint do not change, though contraction strength may be varied.  Isometric exercise or isometrics are a type of strength training in which the joint angle and muscle length do not change during contraction .   Isometrics are done in static positions, rather than being dynamic through a range of motion.  In an overcoming isometric, the joint and muscle work against an immovable object. In contrast, in a yielding isometric, the joint and muscle are held in a static position while opposed by resistance. This is in contrast to isotonic contractions, in which the contraction strength does not change, though the muscle length and joint angle do. An isotonic contraction is one in which the muscle maintains the same tension as it shortens. Suryanamaskar is isotonic . Isotonic contractions come in two varieties: concentric and eccentric. In a concentric contraction, the muscle shortens when its tension is greater than the force opposing it, such as your biceps does when performing an arm curl.  In an eccentric contraction, the force is greater than the muscle tension, causing the muscle to elongate; this happens when going down stairs or sitting down in a chair, as the effects of gravity add to the opposing force. Isometric exercise can be done anywhere using your own body weight.  NASA has researched the use of Yoga ( STATIONARY isometrics plus MOVING isotonics ) in preventing muscle atrophy experienced by astronauts as a result of living in a zero gravity environment. Contractile proteins are what cause muscles to contract and give them their physical strength . Two types of protein in your muscles, actin and myosin, contribute to the basic mechanisms of isotonic contraction.   During this type of contraction, thick strands of myosin and thin strands of actin slide over each other, producing shortening in each individual muscle cell and the muscle as a whole. During isometric contraction, your muscles keep their normal length rather than shortening or lengthening.   An example of this kind of contraction occurs when you hold a weight in front of your body in a fixed position. Without your resistance, the weight would drive your arms and hands downward. Each posture, or asana, is held for a period of time and synchronised with the breath. Generally, a yoga session begins with gentle asanas and works up to the more vigorous or challenging postures. A full yoga session should exercise every part of the body and should include pranayama (breath control practices), relaxation and meditation. By practising just 10 minutes of yoga daily, participants with osteopenia (the precursor to osteoporosis) built their bone density back up into the normal range, while several participants with osteoporosis improved enough to be re-classified as having the milder osteopenia. Yoga helps every which way. When all is lost yoga is the answer

2.47---  prayatnashaithilyanantasamapattibhyam

Perfection in an asana is achieved when the effort to perform it becomes effortless and the infinite being within is reached.

Perfection in asana is reached only when effort ceases, inculcating infinite poise and allowing the finite vehicle, the body, to merge in the seer. The sadhaka can be considered firm in his postures when diligent effort is no longer needed. In this stability, he grasps the physiology of each asana and imbues within, reaching the minutest parts of the body. Then he gains the art of relaxation, maintaining the firmness and extension of the body and consciousness. In this way he acquires a sensitive mind. With this sensitivity, he grooms his thinking faculty to read, study and penetrate the infinite. He is engulfed in the boundless state of oneness, which is indivisible and universal. In yoga one is always on a razor's edge and in asana perfection must be attained through perseverance, alertness and insight. Without these one remains dull and makes no progress. Surrendering to God alone does not make one perfect, although it helps one to forget the tensions of life and of the efforts put in, and guides one towards humbleness even when perfection in asana has been attained. When the sadhaka has reached that state of balance, attention, extension, dissemination and relaxation take place simultaneously in body and intelligence, and they unite in the seat of the soul. This is a sign of release from the dualities of pleasure and pain, contraction and extension, heat and cold, honour and dishonour, etc. Perfection in asana brings unalloyed happiness, blessedness and beatitude.  Light and darkness, pleasure and pain, will not then disturb you.The effect of asana is to put an end to the dichotomies or differentiation between the body and mind, mind and soul. None of the pairs of opposites can exist for the sadhaka who is one with body, mind and soul. When body, mind and soul fuse in a perfect posture, the sadhaka is in a state of beatitude. In such a sublime position, the mind, which is at the root of dualistic perception, loses its identity and ceases to disturb him. Unity is achieved between body and mind and mind and soul. Joy or sorrow, heat or cold, honour or dishonour, pain or pleasure cease to exist. This is perfection in action and freedom in consciousness. Thereafter, one is undisturbed by the dualities. After the awakening of kundalini, the individual will never be the same again. Here there is an ascent of force accompanied by a psychic awakening which is permanently accessible. "As one opens the door with a key, so the yogi should open the gate to liberation with the kundalini. The great goddess sleeps, closing with her mouth,, the opening through which one can ascend to the brahrnarandhra... to that place where there is neither pain nor suffering. The kundalini sleeps above the kanda... she gives liberation to the yogi and bondage to the fool. He who knows kundalini, knows yoga. The kundalini, it is said, is coiled like a serpent- He who can induce her to move is liberated."  Hatha Yoga Pradipika v. 105-111.. Raising the Kundalini  can be equated with the awakening of the silent areas of the brain .Our present consciousness is not independent, as the mind depends on the information supplied by the senses. If you have no eyes, you can never see. However, when the super consciousness emerges, experience becomes completely independent and knowledge also becomes completely independent, as you can access aakashik records. Your mind attains supreme awareness, enlightenment and thus self realization. Unlike the rest around you, you have broken free from the confines of a mental prison in which the human race has been incarcerated for millennia. In   society   our brains   are   structured   in   a   certain   way;   there   is   discipline   and   control   which  inhibit   us from expressing ourselves freely. When the awakening of kundalini takes place, this conditioning is withdrawn and the lid is completely lifted from the mind. With awakened consciousness you can make accurate decisions and judgments because awakening of kundalini is a process of jumping out of the mind. Shiva and Shakti are in total union and only adwaita exists You experience the bliss of non-dual experience . There is a great explosion which transports you into another plane of being .You now have the ultimate experience of Life. You experience yourself as the greatest height and depth of God's being surrounded by an infinite eternal river of bliss. Space and time lose their rigidity, and there is a mingling of the past, the present, and the future. In our dimension of consciousness, the world is not illusory. It is real. But in the next higher state of consciousness it loses its solidity. Chakras can then send out information carrying Soliton waves, which do not attenuate.  The Indian sage has exploded into a space of consciousness in which inner awareness is spontaneous.  Cosmic consciousness is an intellectual enlightenment or illumination, an undescribable state of moral and intellectual elevation, a feeling of amazing bliss. Divine wisdom enables your consciousness to pick up and become aware of superphysical forces and phenomena. Internal amrit or ambrosia floods your body. You now have good all round health with body cells charged with energy, better metabolism, clarity of vision, high perception, high quality of thinking , sharpened and wider human senses psychic abilities , better attitudes, clairvoyance and grace under pressure. You have ignited an amazing dormant power inside you and now can do telepathy, mind reading, spiritual healing, hypnotism, hear clairaudiently , have ability to become invisible and levitate ( with 12 strand NIL junk DNA ) , stop your heart beat and breathing, learn new things quickly, do psychotelekinesis etc. You have awakened your multi-dimensional consciousness, which is basically a DNA upgrade, with changes in the sympathetic and parasympathetic nervous systems.. Shiva represents purusha or consciousness and Shakti represents prakriti or energy . Yogis can live on ambrosial fluid. If its secretion is awakened and controlled in the body, then one needs nothing more for survival. The maintenance of the body's vitality becomes independent of food. You are able to enter into states of hibernation or suspended animation underneath the earth. Pranayama is a yoga of breath , just one of the several methods , used to awaken the Kundalini – or rather disturb  Shakti serpent from its deep slumber at the Mooladhara chakra at the bottom of your spine using heat.  Originating in Muladhara chakra , the Ida nadi ends up in the left nostril and the Pingala nadi ends up in the right nostril.  Once awakened feminine Shakti is eager to mate with her male consort Shiva at the Sahasrara chakra on top of your head .  Most human beings on this planet have never awakened the divine serpent of three and a half coils , and have led base , crude lives and passed on. What a waste. It is the goal of all yogic techniques to balance and harmonize ida and pingala, life force and conscious awareness, so that they join at ajna chakra to create the inner light of knowledge and bliss and reveal the truth. Nadis are flows of energy which move through each and every part of our body, the subtle counterpart of the physical flows such as nervous energy and blood. All of the 72000 nadis in the body are based on ida and pingala which spiral around the spinal cord. These are the basic two modes of function on which all of our bodily and mental processes work. Sushumna is the royal road which takes us to higher awareness and transforms the function of ida and pingala .Each and every cell of our body, every organ, the brain and mind, everything is polarized and interconnected at both the physical and subtle levels, and this allows us to think, speak and act in a concerted, balanced, synchronous manner, every part working to help every other part. There are two basic systems in the body that control this, ida and pingala, and if we stimulate any component of one system we turn on the whole system. This   is   how   asana,   pranayama,   meditation,   and   the   whole   armamentum   of   yogic techniques work. This is how yoga affects the nadis.  Nadis are psychic channels for distribution of prana in the astral body.  The brain has an almost infinite capacity, and all of it within the two kilograms or so of amorphous,   pinkish   grey   brain   matter   with   the   consistency   of   jelly  . How this  jelly-like substance remembers, thinks, analyzes, feels, discriminates, intuits, decides, creates and directs all the countless functions of the body, integrating the whole so that we synchronize action, speech and thought, is something that each of us should ponder about..  The brain, houses the master control systems for the body within its unlimited circuitry, and it contains the circuits for the nadis and chakras. The brain is also the interface between the body and the mind.  All sensory information travels to the brain via the gyanendriyas ( the sense organs of knowledge ), and is then fed into the mind, and all decisions in the mind are then translated into the body via the karmendriyas,( the organs of action ) , in a continuous, seamless , synchronous, dynamic process. Sensory-motor nervous system (SMS)  : all electrical activity in the body moves in one of two directions, into the brain (afferent), ida, and out of the brain (efferent), pingala. Yogis called the sensory nerves which are governed by ida, as gyanendriyas, The motor nerves, governed by pingala,  as karmendriyas. These nerves are concerned with perception of and activity in the world. Autonomic nervous system (ANS) is divided into the outward directed, stress handling, energy utilizing, pingala dominant, sympathetic nervous system, or the inwardly directed, rest handling, energy conserving, ida dominant, parasympathetic nervous system. These two systems control and regulate all the automatic body processes: heart, blood pressure, respiration, digestion, liver and kidney and so on. Central nervous system  (CNS)  consists   of   the   brain   and   spinal   cord   and contains the controls for the SMS and ANS.  The brain contains much more than this though, for it is a huge, ultimately complex computer, which stores and integrates information and puts our decisions into action in a superbly synchronized and orchestrated performance.  Its functioning is definitely much more than its parts. Within the   infinite   circuitry   of   the   brain   resides   more   potential   than   we   can   realize   in   one lifetime, however, the techniques of yoga systematically clear and strengthen these circuits with regular practice. This is what yogis have been telling us, that the circuitry for nadis and chakras exist within the CNS, along the spine and in the brain. If we can tap, purify, strengthen and reconnect these circuits via the various yogic techniques, we can totally transform our mind/  body complex . When one nostril has dominant air flow,  the opposite hemisphere of the brain is dominant.  Forceful breathing through the more congested nostril awakens the less dominant hemisphere The nasal cycle is also linked to the basic rest/activity cycle, which includes within the sleep cycle, the rapid eye movement (REM) phase and the non REM phase, because right nostril/left hemisphere dominance corresponds to phases of increased activity (pingala), and left nostril/right hemisphere dominance corresponds to rest phases (ida).  Buried within the brain are undreamed of capabilities and potentials which can transform our lives if we can tap them. . Chakras act as transducers, converting psychic energy into physical energy and vice versa. They distribute this energy to the body via the nadis. The breath in the right nostril is related to pingala function (left brain), and in the left nostril is related to ida function (right   brain).  By   controlling   the   speed,   rate,   rhythm,   length   and   duration   of   the breath, by altering the ratio of inhalation to exhalation in the nostrils and by stopping the breath, we can activate or tone down neurological and mental processes so as to achieve heightened awareness and altered states of consciousness. Each level in the chakra system is the sum total of various physical, emotional, mental, psychic and spiritual elements. Each chakra has its own neurological plexus and endocrine gland and these link up to various organs and systems in the body. They in turn are connected to the controlling mechanisms of the brain, each of which has emotional, mental and psychic components. The chakra is like a transducer, a linking point between the various levels of our being and it converts and channels energy either up or down to the various levels. Ajna chakra has as its symbol the two-petalled lotus, and we can think of this as representing the two hemispheres of the brain with the pineal gland as its main focusing central point . Cosmic consciousness takes place in sahasrara.  The human brain is still in an organic state of evolution toward higher levels of consciousness. The driving force of that evolution, is the Kundalini energy. Kundalini Awakening is only triggered when you are ready to go through it, because your higher self is actually the source that triggers it.  Your higher-self which is vastly intelligent is not going to give you something which is threatening to your survival.  Resistance to change has always been the human problem, and this resistance comes from our fixed ego aspect.  Our true self wants to evolve and change.  Kundalini awakening is a growing phenomenon and when it happens we cannot turn it off . Kundalini transformation has the purpose to dissolve the last elements of your ego and enlighten you in the body. To become enlightened you have to let go of attachment to all material aspects, which include body, mind and emotions . You are entering into unknown fields, yet there is a rock of stability and that is your ability to be aware . The more you let go of attachment to physical aspects, the more you are guided and the more self-sovereign you become. The more you let go, the more aware you become. This is truly a journey that everyone must take alone, once you are prepared for the journey,  under a guru. Nadis exist in the etheric body, unseen to the naked eye and is based on energy currents, vibration and psychic energy . Kundalini rises only when the state of purification of the nadis and chakras has progressed far enough.  The goal of many of the yoga practices is to purify the nadis, and then to cause the prana and apana to meet and rise up through the sushumna. Balancing Ida and Pingala  balances the sympathetic and parasympathetic branches of the autonomic nervous system, reducing the elevated flight or fight response.  In other words, the single act of balancing the breath is a tremendous aid in physical stress reduction, in addition to being a spiritual practice setting the stage for Kundalini Awakening.   Like I said before out of these 72,000 subtle nadis only 3 nadis are very important.  They are Ida, Pingala and Sushumna.  The 10 main nadis which carry prana out of the 72000 are Ida, Pingala, Sushumna, Gandhari, Hastijihva, Pusa, Yusasvini, Alambusa, Kuhuh and Sankhini . The Ida is feminine ( irrespective of gender ) , left sympathetic nervous system, on LH side of spinal cord,  tamas- yin negative charge polarity energy, represented by cooling moon, connecting to left nostril, controls mental processes, connects to RH brain lobe, pale colour.  The Pingala is masculine ( irrespective ofgender ) , on RH side of spinal cord,  rajas-yang positive charge polarity energy , represented by heating sun, connecting to right nostril, controls vital processes, connects to RH brain lobe, red colour,  Both ida and pingala ends between the eye brows—at Shiva’s third eye. The Medullar Sushumna, which interpenetrates the cerebrospinal axis from the perineum to the juncture of the lamboid and sagittal suture of the cranium, and is associated with both nostrils being open and free to the passage of air.   Sushumna-Sattwa is at the back of the anus, in the middle of the Spinal chord and is the most important of all nadis, neutral charge energy . It is attached to the spinal column and extends to the Brahmarandhra of the head and is invisible and subtle.  If the coiled-up energy, Kundalini, passes up along the Sushumna Nadi and is taken up from Chakra to Chakra the Yogi gets different sorts of experiences, powers and Ananda ( bliss ). When ida and pingala get balanced and unite in the activated sushumna, pure consiousness arises.  It is only when prana moves into the sushumna that the latent spiritual power of  kundalini can be awakened. Kundalaini is the power of pure consciousness, the dynamic potential of the soul. It is the Divine Mother Herself, visualized as a serpent coiled three and a half times, with its tail in its mouth. One of the objects of activating the spiral fire and its progress up the spine to the head is to awaken the pineal gland, which results in the opening of the third eye and the consequent revelation of the subtler planes of life When it reaches the brain, the yogi is perfectly detached from the body and mind; the soul finds itself free. Again, the goal of the sadhaka ( the man who does meditation) in his sadhana (meditating practice) is to bring the hood of the kundalini to Sahasrara chakra through Sushumna situated in between Ida and Pingala.  That is when the hood reaches head or Sahasrara chakra, the tail of the 3.5 coiled serpent will reach Mooladharachakra. While doing meditation the awakened kundalini should raise neither through left side Ida nor through right Pingala but through centre Sushumna nadi only. If not the sadhaka will get traumatic results. Ida and pingala function alternately and directly influence the temperature of the body, digestive and hormonal secretions, the brainwaves and all the bodily systems. Ida and pingala function according to a natural cycle, but on account of poor eating habits, pollution  and inharmonious lifestyles, the natural cycle is often disturbed.  Sometimes one nadi predominates and the other is suppressed. This leads to mental and physical imbalances and generally results in disease. Therefore, ida and pingala must be disciplined or made to function according to the laws of nature. Only when there is harmony between these two nadis can sushumna be awakened.  When sushumna awakens, kundalini ascends straight to sahasrara and one becomes a jivanmukta, a liberated soul . "A hundred and one are the arteries of the heart, one of them leads up to the crown of the head. Going upward through that, one becomes immortal." (CU 8.6.6) Chandogya Upanishad 5000 BC.From then on, the sadhaka is undisturbed by dualities. Sahasrara is the culmination of yoga, the perfect union between shiva and Shakti and the unfolding of enlightenment.   When this union takes place, the moment of self-realization or samadhi begins. At this point the individual man dies.  I don't mean that physical death occurs, it is death of the mundane awareness or individual awareness.  It is death of the experience of name and form. At this time you don't   remember   the   'I',   the   'you'   or   the   'they'.  The   experience,   the   experienced   and   the experiencer are one and the same. The seer, seeing and and seen are merged as a unified whole. In other words, there is no multiple or dual awareness. There is only single awareness. When Shiva and Shakti unite, nothing remains, there is absolute silence. Shakti does not remain Shakti and Shiva is no more Shiva, both are mingled into one and they can no longer be identified as two different forces.  In due course the Kundalini energy comes down, ideally taking residence in the heart anahata chakra,  balancing upper and lower chakras.  You live a normal life, associating with everybody and discharging your worldly obligations like other people do. Now you are in the midst of games of victory and defeat,  attachments and infatuations,  but you just play a game.  You know it; you do everything as an actor.  You are not involved in it life and soul .  People recognize you as a divine incarnation reality.  When Shiva and Shakti descend to the gross level of awareness there is again duality. That is why the self-realized man is able to understand pain and all the mundane affairs of life.  He understands the whole drama of duality, multiplicity and diversity.  Sometimes we ordinary mortals are at a fix to understand how this man with the highest attainment is able to cope with the hopeless dualities of life.  Shakti rules the matter and Shiva rules the consciousness, and when they descend to the gross plane, Shakti continues to rule the matter and Shiva, being consciousness, gives an understanding to the whole world. As the liberated energy (Kundalini) courses through the system, it actually sweeps away samskaras – karmic traces from the past that are still imprinted in the body and mind – like floodwaters clearing clogged debris from a river bed. When Shiva and Shakti unite in sahasrara, one experiences samadhi, illumination occurs in the brain and the silent areas begin to function . Shiva and Shakti remain merged together for some time, and during this period there is a total loss of consciousness pertaining to each other.  At that time a bindu evolves. Bindu means a point, a drop, and that bindu is the substratum of the whole cosmos.  Within that bindu is the seat of human intelligence and the seat of the total creation. Then the bindu splits into two , Shiva and Shakti manifest again in duality. When ascension took place it was only the ascent of Shakti, but now, when descension takes place, Shiva and Shakti both descend to the gross plane and there is again knowledge of duality. Kundalini in Sanskrit literally means “coil.” Kundalini is the cosmic energy that lays dormant at the base of the spine in the perineum, and is symbolically depicted as a serpent. Keep your mind open about all this. This is NOT Indian snake charmer mysticism . Imagine, the white man called us savage snake charmers.

Dayanand was given the title of MAHARISHI by Jew Rothschild for denigrating Hindu gods. 

He was the first to do it in a worse manner than Zakir Naik or UR Ananthamurty. 

UR Ananthamurthy pissed on a Vishnu idol being worshiped by people, to prove that Hindu gods are powerless and cant strike back. 

The benami media,the collegium judiciary , the literary fest drohis etc applauded UR Ananthamurthy and he got several awards for being intelligent and non-superstitious . Sorry ,there is NO superstition in Hinduism.. 

Zakir Naik ridiculed Ganesha and Shiva – in extreme sarcasm he told “ What type of god Shiva is ? He could not even recognize his own son Ganesha , cut off his own son’s head and then fixed an elephants head instead. 

These idiots do not know that Hindu gods ( except Vishnu avatars ) are all cosmic forces at the macro and micro level. 

Check out what our Rothschild darling Dayanand Saraswati did for which Rothschild media applauded him worldwide. 

Let me quote Wikipedia—

QUOTE: On the occasion of Shivratri, Dayananda had to sit awake the whole night in obedience to Lord Shiva. One such night, he saw a mouse eating the offerings to the God and running over the idol's body. After seeing this, he questioned himself, if the God could not defend himself against a little mouse then how could he be the savior of the massive world. UNQUOTE

This is the type of morbid accusation Zakir Naik and UR Ananthamurthy made.   

APCO branded Modi praised UR Ananthamurthy when he died.  

Jew darling Modi has the unique knack of praising all Jew Rothschild’s agents and FAKE creations.

Ganesha’s mother Parvati ( shakti ) cannot rise up the sushumna nadi into the arms of his father ( purusha ) by kundalini raise, unless Ganesha allows. 

These are not mortals but forces of energy.

http://ajitvadakayil.blogspot.in/2012/06/lord-ganesha-and-milk-drinking-episode.html

Tantric art has captured the images of the Purusha and his consort, Pragati, in ecstatic union.  

This is NOT perverted sex.  

Purusha and Pragati is expressed as Shiva and Shakti in the same body 50:50 – this is NOT a she boy or a transgender .  It is a mindboggling,  intelligent concept. 

Each of the trinity gods are powerless without their consorts. 

In the Tantric cosmology, the whole universe is perceived as being created, penetrated and sustained by two fundamental forces, which are permanently in a perfect, indestructible UNION. 

These forces or universal aspects are called Shiva and Shakti.

In Hinduism we have placed the female on a pedestal . No man can do a yagam if he is a bachelor or a widower. 

Purusha is the embodiment of pure consciousness, and Pragati as the embodiment of pure energy.

Both Shiva and Shakti are Consciousness---- Shiva is the changeless static aspect of Consciousness, and Shakti is the kinetic, active aspect of the same Consciousness.

Through uniting with Purusha , Pragati gave form to his spirit and created the universe.(we are talking about CREATION OF THE COSMOS here- not street side sex  as figured out by small minds)

When the insentient Prakriti comes in contact with the sentient Purusha , the universe evolves.

Purusha ( Shiva ) symbolizes consciousness, the masculine principle. Prakriti ( Shakti/ Parvati ) symbolizes the feminine principle, the activating energy.

The cosmos in all its manifestations, as an act of love.  The relationship between say- Shakti and Shiva is the dance of consciousness and energy experienced within each of us, regardless of gender.

Shiva resides in the highest Sahasrāra Chakra and Shakti ( Parvati ) in the lowest Mūlādhāra Chakra.   

Above: Ganesha controls the perineal knot of Brahma Granthi .   Granthis are the energy knots or blocks in our personality where the energy and consciousness interact, to manifest in a particular way.  The three Granthis are of  the TRINITY who always work in harmony ( Brahma/ Vishnu / Shiva )

Ganesha controls the Mooladhara bandhan ( Brahma Granthi gateway/ knot  ) and his parents cant unite unless Ganesha wants it.  

( This is what IDIOT  Zakir Naik was telling about Ganesha guarding the toilet door when his mother was taking bath )  

When Prakriti and Purusha unite in the Sahasrāra Chakra ( raising of Kundalini ) , knowledge, knower and the object of knowledge become one.  

 The eternal and indestructible union between Shiva and Shakti gives birth to the whole Macrocosm, in its stable, static aspect as well as in its dynamic one. 

Not only is Shakti responsible for creation, it is also the agent of all change

Shakti is manifested by Shiva only during creation and is withdrawn into himself at the end of creation. This is for the perceptive.

Modern science repeats from our Vedas that matter and energy are interchangeable.  So does consciousness and energy .  

In the highest planes they are interchangeable, which is why we see a great incongruence between our spiritual experiences and the external reality.

In the higher metaphysical realms and subtle planes of our consciousness the physical laws of our universe lose their validity.

Tayor yad yamalam rupam sa samghatta iti smrtah---

Ananda-saktih saivokta yato visvam visrjyati,

Na Sivah Saktirahito na Saktih Sivavarjita.  

---(Tantraloka-Ahnika, 3.)   5000 BC

"The coupled form of these two (Shiva-Shakti) is called junction.  That is called the blissful Shakti from which creation arises”

There is no Shiva without Shakti, nor Shakti without Shiva."

Samkhya as you can see was a masterpiece of modeling the ways of the inner universe.

The union of Shakti with Shiva by Kundalini rise  is the liberation of seeker from the cycle of endless birth and death.

The soul ( atman ) now attains highest frequency to merge with the mother field of brahmAn—we call this moksha , the aim of every Hindu.

What do all these characters like Zakir Naik, UR Ananthamrthy, Maharishi Dayanand Sarasawi, Kalburgi, Pansare, Dhabolkar, Kancha Ilaiah SQUEAK nay Shephard , BR Ambedkar, EVR Periyar, Mahatma Phule saab, Wendy Doniger, Sheldon Pollock, literary fest drohis , white skinned Indophiles, JNU commie professor . Amish Tripathi, Devadutt Pattanaik etc know?

WHY DO YOU THINK I HAVE STARTED THIS BLOGSITE ? 

WHY DO YOU THINK I HAVE BECOME THIS PLANETs NO 1 WRITER , WHEN I HAVE NOT EVEN STARTED ? 

EVEN MENTAL COPULATION HAS NOT BEEN INITIATED, LEAVE ALONE HOLDING HANDS , KISSING, PETTING, HUMPING,  EJACULATION AND PILLOW TALK .

Have you read Swami Vivekananda’s commentary of Patanjali sutras ?   

Is there ONE SINGLE SENTENCE ---  repeat--- ONE SINGLE FUCKIN' SENTENCE of Vivekananda which we Hindus branded as heathen pagan savages by the white man can be proud of ? 

Below is his Vivekananda’s pathetic nay morbid understanding of Patanjali’s yoga sutra .

http://hinduonline.co/DigitalLibrary/SmallBooks/PatanjaliYogaSutraSwamiVivekanandaSanEng.pdf

Does Vivekananda like Dayanand Saraswati even understand an iota the glory of Sanatana Dharma?

"When the Brahma granthi (in the heart) is pierced through by Pranayama, then a sort of happiness is experienced in the vacuum of the heart, and the anahat sounds, like various tinkling sounds of ornaments, are heard in the body." Hatha Yoga Pradipika. 4.69 5000 BC

Brahma granthi controls the energies of mooladhara and swadhisthana chakras. It is linked with the urge to procreate and with deep survival instincts , instinctive knowledge, awareness and desires of sex. It is known as blockage of Brahma because it holds our consciousness at the level which is related to the desires of the physical dimensions like sensuality, sex, procreation and the instinctive urge to survive which cannot be transcended.

Once this blockage is removed from the realm of consciousness and energy, instincts of the deep rootedness and energy are released. The kundalini or primal energy is thus able to rise beyond mooladhra / swadhisthan without bogged down by the attractions to which our consciousness is hooked. Lord Brahma Gives the way.

Rudra granthi governs ajna and sahasrara chakras. It represents the transformation of an existing form, idea or concept into the universal aspect.  Here there is a breaking away of the old, the ego awareness, the "I" Awareness, the mental awareness, the physical awareness .The sixth sense or the eye of intuition, as the third eye of Lord Shiva is now open. You are now liberated. A liberated man does not get vestigial goosebumps.

The granthis, the knots of avidya-kama-karma, are to be untied—not broken through. Ganesha must untie the first knot at the Mooladhara Chakra and guides his mother via the safe sushumna nadi passage.

"When the Rudra granthi is pierced, and the air enters the seat of the Lord (the space between the eyebrows), then the perfect sound like that of a flute is produced." Hatha Yoga Pradipika. 4.75 --5000 BC

WHAT DO MODERN SCIENTISTS WHO ADORE MADMAN CHARLES DARWIN KNOW ?

IT TAKES A CAPT AJIT VADAKAYIL TO TELL THE PLANET ABOUT A VESTIGIAL ORGAN NAMED APPENDIX . 

THE TRINITY DECIDES IF VESTIGIAL ORGANS MUST BE ACTIVATED OR NOT.

http://ajitvadakayil.blogspot.in/2011/02/human-appendix-misunderstood-organ-capt.html

Sanathan DharmJuly 31, 2016 at 3:22 AM

Only you can explain Patanjali sutra and all about Hinduism we are blessed to know you. God bless you and family. Captain will you please explain Vigyan Bhairava Tantra of lord shiva

Hi, sd,

The white invader reduced Tantra to perverted sex.

In Vigyan Bhairava tantra, Shiva the first yogi, responds to his wife’s query about methods of Dhyana –he gives her 108 ways.

Let me just quote one of them.

Ahara means food.  But this is just one aspect. Any sensory input to your body and mind is an ahara. When you hear music it is ahara via your ears. When you see a silent movie it is ahara via the eyes.

The term pratyahara is composed of two Sanskrit words, prati and ahara.  Indriya Pratyahara means literally "control of ahara/ sensory inputs ,"  or in more erudite terms "gaining mastery over external influences."

Just as a healthy body can resists toxins and pathogens, a healthy mind can ward off the negative sensory influences around it.   

If you are easily disturbed by the noise and turmoil of the environment around you,  or jolted out of your mind by every small pothole of stress on the street of your life, practice  pratyahara. 

Without it, you will not be able to meditate.

There are higher levels of Pratyahara.   Examples?  Prana- pratyahara — control of prana . Karma-pratyahara — control of action,  mano-pratyahara — withdrawal of mind from the senses.  These are beyond the scope of this post.

  

Shambhavi literally means - pertaining to Lord Shiva. Mudras are methods to control the flow of energy within the nadis of a human body.

Pure awareness is a simple experience —just a small gap in your thinking when you are without ego -- a small space of nothing--shuniata.

So so so-- “Nothing” doesn’t give answers?

It is the answer. !!

Sabarimala pilgrimage is based on this priceless method.

http://ajitvadakayil.blogspot.in/2013/01/sabarimala-makaravilakku-three-light.html

Deep peace is the side effects of this experience of “no-thing” or “no-thought.”  It is the realization that you are more than your thoughts.  Something is there beyond your mind. 

Quantum entrainment  is a process that instantly gives the body, mind and spirit deep rest and fast healing.  It works in seconds.  Yes, pure awareness is the deepest rest you can ever get—and it is so dang easy .

Quantum entrainment seeker does “nothing,” yet everything gets done for him.

When we allow pure awareness to suffuse our consciousness, the magic begins.   Quantum entrainment effectively heals the body, mind, emotions, and spirit and centers you . 

शांभवी मुद्रिकाः कृत्वा आत्मप्रत्यक्षमानयेत।

बिन्दु ब्रह्ममयम दृष्टवा मनस्तत्र नियोजयेत॥

सत्यं सत्यं पुनः सत्यं सत्यामाह महेश्वरहः।

शांभवी यो विज्ञानियात्स च ब्रह्म न चान्यथा॥

~ घेरंड संहिता

By assuming the position of Shambhavi Mudra a Yogi should see the self.  When the Brahma is seen in the form of a dot he should fix his mind on it and nowhere else.   A Yogi who knows the science of Shambhavi he himself becomes Brahma  and none else.   I, Lord Maheshwara (Shiva), am telling this again and again that this is truth.-   Gherand Samhita ( Hatha Yoga ) 5000 BC

Gheranda Samhita is a 7 tier yoga:--

Shatkarma for purification

Asana for strengthening

Mudra for steadying

Pratyahara for calming

Pranayama for lightness

Dhyana for perception

Samādhi for isolation

The white invader has kicked forward Gherand Samhita by an amazing 6600 years --thank god that they did NOT claim to have written it like our Vedas .

As per the 7000 year old Vedas,  perception occurs in the gap of alert attention. This is the inner space.  There are many methods to create this gap.  Shambhavi Mudra is the most potent and easiest method.

Negative thoughts  create negative feelings and hence stress and illness.  Our inner voice evaluates, judges, compares and worries.   Most people live with such a tormentor in their head draining them of energy.

It is an awful burden not to be able to stop thinking.  Up to 90 % of most people’s thoughts are meaningless playbacks of old broken “records”.

Silencing the body is easy, but silencing the mind is difficult in this modern age.  Silencing is about grace, harmony and tranquility. Exhaustion ( the way of OSHO who fooled the shallow minded west )  or being drugged out of your mind is NOT tranquility.

In the modern age people get stressed, and they need to still the mind--the chattering monkey, which remains entangled in the past and the imagined future, but never in the present.  A person stops thinking either when he is dead or when he has realised. 

When your ego powered mind is chattering like a monkey or the angry sea, you miss the truth.  Truth can be communicated only in silence. For this deep silence you need to have harmony between the mind, body and spirit.

Shambhavi Mudra synchronizes the 2 brain lobes to create inner balance.  When the left and right sides of the brain , are in balance the human DNA generates scalar waves.   When two energy fields exactly cancel out each other the 5th dimension is accessed which is all pervasive and has the power to heal. 

He is now in touch with higher levels or higher dimensions of functioning.  He will have  emotional stability and level headed approach to problems which confront him.  This is a fast,  amazingly simple, drug-free method of stimulating neural pathways in the brain.

Shambhavi Mudra is an act of concentrating on the inner third eye of Shiva ( Ajna Chakra ).  It does NOT mean that you have to try and look up at the centre of your forehead or the space between your eyebrows like a squint eyed nincompoop.

All right, now let me talk about practicals.

Wear loose fitting clothes which does NOT constrict you in any way.  Sit on a smooth surface , in a comfortable meditation pose .  This is to eliminate sense of touch / feeling.

Put your thumbs in your ears and palm your eyes with your middle and fourth finger.

Now do OM CHANT with an audible MMMMMMM.

You will feel intense vibrations inside your ear — the cochlea spiral passage resonated to 7.83 hertz ( OM frequeny and also earth’s heart beat frequency ) and your brain produces NITRIC OXIDE .

Now select a silent, NOT so bright, cool place space, where there are NO strong smells  .  This is to prevent any input of sense of hearing/sense/ smell .   If you can even feel the clock ticking-put  ear plugs –only if you are a beginner.

Keep the head,  shoulder and spine upright and straight.  And place the hands on the knees in (Jyana Mudra).  Upright is to keep the spirit level in the inner ear at equilibrium so that your brain lobes get balanced and synchronized.

Shut your eyes.   No need to be cockeyed .

Simply be mindful of in-and-out diaphrgmic breathing where you stomach rises and falls.   You may feel that your breathing is too short, too long, too gentle or too heavy.  Do not try to control it. 

When you become distracted, gently refocus your attention on your breathing.   Restrict your attention to what is occurring in the immediate present moment.  

When you feel you have blocked out all ahara ( feed ) via your senses of smell, sight, hearing and feeling , take a deep breath where you fill your lungs only 90 % and hold it .  Put your tongue on your upper palate and tickle it for just 2 seconds and stop.

Now start exhaling VERY slowly while keeping the tip of your tongue stationary on the roof of your mouth.

Don't think about the past or future— don't think about anything at all.  Let go of worries, concerns , and memories.  Empty your mind of everything. 

To be frank you cannot think even if if want to —I can challenge you on this . 

Do this 3 more times .  This means you inhale again , hold your breath and do the same thing.

Later on you do NOT need to hold your breath and you can do this procedure for LONGER TIME , without ear plugs and your eyes open against a blank far away wall of your room.

Do this exercise 5 times a day.  You must NOT have a full stomach.   You can drink some water before you do this.

This is it !

—so simple so fast , right?

The difference between prayer and meditation is that the former is a petition to God, and the other is a detached observation of one's own mind, and its processes, after squelching the 5 senses . 

The aim of every form of meditation is to still the mind, or you cant purify it and get rid of deep rooted negativities , which affect your health.   If you do meditation the right way , you mind will NOT control you –rather you will control your mind.

For a layman-- you are stressed when your hands feel cold, your heart rate, breathing, and muscle tension increases.  The result is that your immune system goes for a toss and you get depressed or burnt out.. 

Depression is a weird feeling of loss.

  

Before SHAMBHAVI MUDRA is it good to hear the noise of the shankh.  This is a harmonic of Hindu King mantra OM of frequency 7.83 hertz, which is also the earths heart beat called Schumann’s resonance

The conch shell air passages have been moulder by the morphogenetic consciousness field. This field is the Advaita Hindu god brahmAn . 

Contrary to what the immoral idiots of other religions ( who ridicule Hindusim as with 33 million gods )  think— our God is an intelligent field which sustains the golden mean of 1.618 . This ratio is the basis of our 11000 year old divine geometry Sri Yantra which holds the theory of everything .

The pathway of the longitudinal sound waves through the passages of the shell conch follows the golden mean spiral, and it has a positive effect on the cochlea spiral, which is basically a scalar wave generator when impinged by longitudinal sound waves of desired frequency.   This has been noticed by using Kirlean cameras.

Scalar fields permeate the body tissues and enhance ion transport at cellular level..   In every Hindu temple a shank conch exists. It stimulates the Amygdala with positive vibrations .  You enter a mysterious state of psychological flow.

Healing is NOT a physical process, rather it is mental. Modern medicine is all about destroying the symptoms .  ( never mind a pancreas is doing its job faithfully—hey, remove it ). 

Mind can wipe mistakes off the DNA blueprint and destroy any disease that has disturbed the design.  DNA's ability to repair itself is affected adversely when a person is in depression.

Meditation experiences silence, and is devoid of drives, wishes, fears , thoughts and emotions. Afterwards when the mind returns to its usual level of consciousness, it has acquired some freedom to move.. 

Grace and peace are the hallmarks of a healthy non-delusional mind in a healthy body.. The happiness is stable.  

Do Shambhavi Mudra in a grateful frame of mind , to thank the universal laws, which sustain this planet. 

For people who do NOT know what the amygdala is—

All sensory data must first pass through the amygdala for emotional analyzing, before being sent off to the cerebral cortex for processing.

The amygdala has in turn been implicated in nearly every psychiatric disorder.

Children with anxiety disorders tend to have a smaller left amygdala. Amygdala uses more blood than any other part of the brain.

We humans are conscious creatures because we have more amygdala nuclei.

There are functional differences between the right and left amygdala.

Electrical stimulations of the RIGHT amygdala induce negative emotions, especially fear and sadness.

Amygdala is the center for emotional intelligence, as all sensory data must first pass through the amygdala for emotional analyzing, before being sent off to the cerebral cortex for processing.

Do Shambhavi mudra to overcome emotional and mental blocks that create negativity and spoil your social relationships. .

Do it to boost your immune system and to improve  health and happiness by allowing the body’s natural intelligence to do whatever it takes.

People without wisdom slog throughout their lives to earn money.   Just when they are about to retire and enjoy the fruits of their labour they find that they too sick .  All their life’s earnings get swiped off in hospitals. 

He now becomes a burden to the same people whom he loved and nurtured throughout his life.

Rings a bell?

The earliest documented use of the word Tantra is in the Hindu text, the Rigveda (X.71.9) of 5000 BC, which show Tantra existed , especially in Kerala Malabar, and the NE of India before the Vedas were written.

Tantric spiritual practices and rituals  aim to bring about an inner realization of the truth that "Nothing exists that is not Divine" (nāśivaṃ vidyate kvacit ) . Tantra deconstructs all pre-conceived notions of the human condition.  This allows the person to experience total liberation and then unity with ultimate truth or reality.

Tantra seeks to access the supra-mundane through the mundane, identifying the microcosm with the macrocosm. Tantric practitioner seeks to use prana, an energy that flows through the universe (including one's own body) to attain goals that may be spiritual, material or both. 

The Tantric aim is to sublimate rather than to negate relative reality. This process of sublimation consists of three phases: purification, elevation, and the "reaffirmation of identity on the plane of pure consciousness.

The word Tantra means "to manifest, to expand, to show and to weave." In this context, sex is thought to expand consciousness and to weave together the polarities of male (represented by  Shiva), and female (embodied by his wife Shakti), into a harmonious whole. 

The basic principle of Tantra is unity. That can be expressed in many forms. It could be unity with the world around you, or unity of spirit, which brings peace and clarity, or when related to sex, the unity of man and woman to bring about the ultimate pleasure and fulfillment. Once you achieve the desired unity, you reach a higher consciousness and connect with a divine place.

When discussing Tantra and the idea of unity, it is necessary to include Shiva and Shakti, who represent masculine and feminine archetypes in Hindu symbolism. 

Shiva, the male, is pure consciousness; Shakti, the female, is the power of creation — she's the life force energy that combines with his power of thought to manifest the physical world. One cannot exist without the other, as the two are inseparable and it takes both powers working in harmony to keep the universe functioning

Vigyan Bhairav Tantra was about 108 forms of meditation ( dharana or centering techniques ) to achieve cosmic consciousness. Bhairava is “ beyond consciousness “—a NO MIND STATE.

Vigyan Bhaiva Tantra was penned down 7000 years ago.

Vigyan Bhaiva Tantra starts with a question from Devi regarding the nature of reality. Parvati asks Shiva about Universe, about fundamental nature of this world, how one can go beyond space and time to understand this truth.

The book is all about Shiva’s answers to Devi’s queries. He does not tell her what is. He goes on and on giving her different dharanas.

The book starts with Parvati asking her husband Lord Shiva -

O Shiva, what is your reality?

What is this wonder-filled universe?

What constitutes seed?

Who centers the universal wheel?

What is this life beyond form pervading forms?

How may we enter it fully, above space and time, names and descriptions?

Let my doubts be cleared!

She is NOT asking him about how to lick an purulent as$hole or suck a syphilitic di#k or slimy methods to steal another man’s wife .

Single messiah/ holy book readers will NOT understand the ramifications of Lord Shiva’s replies, as it is in such a loft plane.

It is NOT a dialogue between a Guru and shishya—but a dialogue between two lovers—and hence is refreshingly incisive, where the BEYOND IS EXPRESSED.

You need not be a woman to be a disciple, but you need to be in a feminine attitude of receptivity.

Philosophy ( every fu#kin’ philosophy is a lie ) is concerned with the mind and the brain is enough; your totality is not required. Tantra needs you in your totality, your every cell among trillions .

Shiva tells Parvati –take your pick-- he tells her to choose anyone of the 108 methods.

Yoga is suppression with awareness; tantra is indulgence with awareness.

Lord Shiva gives his wife Parvati most profound methods of centering oneself using a lover ( this is NOT sex) , achieving pure awareness, quantum entrainment, consciousness , prana amplification , focusing the mind like a laser beam, the meaning of OM, channeling the breath for Nitric oxide boost, the alpha / theta frequency states, nadis, bindu of Sri Yantra geometry , shabda brahman, advaita brahmAn , raising kundalini, the chakras, mudras, tattwas, delusions of Maya, core of Shakti etc etc -

The modern man is NOT intelligent enough or perceptive enough to understand the ancient Tantra—which has been reduced to sex and perversion.

Tantra stands for deep experiences. Anything experienced can be transcended; anything suppressed can never be transcended.

If at all sex is involves it is only to achieve purity. A small child is NOT aware that he is stealing . He is NOT aware of his nakedness. This is why we Hindus do NOT cremate our young children who die. They do NOT have egos .

Their minds are not harnessed by laws . Tantra transcends the mind and accept the whole of the human in complete totality . Mind is an order and it lives with definitions and disciplines..

Tantra method is to be aware of the desire , NOT to create any fight, but to move in desire with full consciousness,and only then you can transcend it.

Yoga is outgoing energy, while tantra is energy moving inwards.

Tantra is about depth, while yoga is about height.

HOW MANY OF OUR FAKE GURUS, LIVING IN LUXURY, HAVING 150 BRANCHES THROUGHOUT THE WORLD, WHO PRAISE HOMOSEXUALITY -- WHO COME ON BENAMI TV HAVE EVER TOLD YOU ALL THIS ?

I watch evangelist TV stations to have fun. I laugh my guts out.   The pea brained evangelist would be explaining Vedanta – and in between he will shove in Jesus in a most mindless fashion.   

 BLAH BLAH - Jesus expressed that consciousness by saying, "where I am," instead of "where I will be after the death of my mortal body"; and later when he said: "Before Abraham was, I am."[John 8:58 ]-  BLAH BLAH 

JohnJuly 31, 2016 at 2:51 PM

Dear Captain Ajit,

I have been following your blog very sincerely for some time. So much of the information is original and not to be found anywhere else on the internet. But I was surprised by your article on brahmacharya. India is the origin of the idea of celibacy and there still even today many in India who follow this noble way of life, though they will not found in the big cities( or aboard ships!) .

Brahmacharya is semen retention, plain and simple – and this done through protecting the mind zealously and by being alone by oneself almost all the time. The eyes are protected – Visual Brahmacharya just as the mind. Then there will not even by nocturnal emissions.

By saying that brahmacharins are homosexuals, you are doing a great dis-service to India and Indians . There many young people who follow your blog and this article will do them great harm. Also even to Westerners who look up to India for matters of the Spirit. It will also reduce the credibility of your other articles where you are undoubltedly right.

I am also surprised that nobody has bothered to correct such a big faux pas on your part. Or is it that you do not publish comments which are critical unless you also post a rejoinder? If that is the case, this comment might also not see the light of day! Whether you publish this or not, please think about it – Is it possible for a person who is living a worldly life and who is not a celibate to really understand this way of life without living actually it? This is like a person who has never entered the water all his life, trying to explain butterfly stroke!. There is no question of doubt. Sir, you very very wrong regarding your views on Brahmacharya.

Regards,
John

1. Capt. Ajit VadakayilJuly 31, 2016 at 3:24 PM

   hi j,
   
   PEOPLE WITH COMMONSENSE WILL NEVER CONFUSE CAUSE AND EFFECT.
   
   EXAMPLE: A SHIP RAN AGROUND AND THE MAST FELL DOWN . ONLY A DRIPPING CHOOT WILL SAY THAT THE MAST FELL DOWN AND SO THE SHIP RAN AGROUND.
   
   IF BY WITHHOLDING SEMEN YOU CAN MOVE CLOSER TO LIBERATION --THIS IS THE BIGGEST CROCK OF SHIT ON THIS PLANET.
   
   ON THE OTHER HAND--
   
   BY SPIRITUAL PRACTICE AND YOGA IF YOU MORE CLOSER TO LIBERATION ,( AND IF MISS WORLD SITS ON YOUR LAP , IT IS THE SAME AS YOUR PET CAT SITTING ON YOUR LAP ) WELL THEN SEMEN RETENTION IS EMINENTLY POSSIBLE.
   
   THE BLOG SITE WILL NOT ALLOW HOMOSEXUALS AND TATTUS ( WHO CANT GET IT UP ) TO FOOL THE HINDUS ANY MORE, BY IMPLYING THAT THEY ARE LIBERATED.
   
   AMONG THE CURRENT FAKE GURUS , I KNOW WHO ARE ALL HOMOSEXUALS AND WHO ARE ALL TATTUS ( WHO CANT GET IT UP )-- BASTARDS WITH FEEBLE AURA RIDDEN WITH DARK HOLES . THEY WERE HAVING ANAL SEX / ORAL SEX EVEN IN SCHOOL.
   
   NONE OF OUR ANCIENT MAHARISHIS WERE UNMARRIED, UNLESS IT WAS BECAUSE THEY TOOK SOLEMN VOWS , AS A PERSONAL SACRIFICE TO BENEFIT THEIR BENEFACTORS.
   
   I AM THE FIRST TO WRITE AFTER ADI SHANKARACHARYA THAT HOMAMS AND YAJNAS CANNOT BE PERFORMED BY MEN WHO ARE UNMARRIED OR ARE WIDOWERS.
   
   I ASK THE POPE-- STOP THIS NONSENSE OF FORCING YOUR CATHOLIC CLERGY TO BE UNMARRIED WITHOUT FAMILY
   
   ADI SHANKARACHARYA DIED 100 YEARS BEFORE BUDDHA WAS BORN. BUDDHA WAS BORN IN 1900 BC ( NOT 1400 YEARS LATER AS RECORDED BY THE WHITE MAN ).
   
   capt ajit vadakayil
   ..

2.48— tato dvandvanabhighatah

From then on, the sadhaka is undisturbed by dualities.

Dvandva is about duality, the dance of opposites- the essense of Dvaita Vedanta.  Liberated people are not affected by dualities of Maya.The effect of Yoga is to put an end to the dichotomies or differentiation between the body and mind, mind and soul. None of the pairs of opposites can exist for the yogi who is one with body, mind and soul. When body, mind and soul fuse in a perfect posture, the sadhaka is in a state of beatitude. In such a sublime position, the mind, which is at the root of dualistic perception, loses its identity and ceases to disturb him. Unity is achieved between body and mind and mind and soul. Thereafter, one is undisturbed by the dualities.

पतंगमक्तमसुरस्य मायया हृदा पश्यन्ति मनसा विपश्चितः ।

समुद्रे अन्तः कवयो वि चक्षते मरीचीनां पदमिच्छन्ति वेधसः ॥१॥

पतंगो वाचं मनसा बिभर्ति तां गन्धर्वोऽवदद्गर्भे अन्तः ।

तां द्योतमानां स्वर्यं मनीषामृतस्य पदे कवयो नि पान्ति ॥२॥

अपश्यं गोपामनिपद्यमानमा च परा च पथिभिश्चरन्तम् ।

स सध्रीचीः स विषूचीर्वसान आ वरीवर्ति भुवनेष्वन्तः ॥३॥

The wise behold with their mind in their heart the Sun, made manifest by the illusion of the Asura;

The sages look into the solar orb, the ordainers desire the region of his rays.

The Sun bears the word in his mind; the Gandharva has spoken it within the wombs;

sages cherish it in the place of sacrifice, brilliant, heavenly, ruling the mind.

I beheld the protector, never descending, going by his paths to the east and the west;

clothing the quarters of the heaven and the intermediate spaces. He constantly revolves in the midst of the worlds. — Rig veda X.177.1-3, 5000 BC

The above Maya-bheda hymn discerns, using symbolic allegory, a contrast between mind influenced by light (sun) and magic (illusion of Asura). The hymn is a call to discern one's enemies, perceive artifice, and distinguish, using one's mind, between that which is perceived and that which is unperceived.  You can hardly expect Kancha Ilaiah SQUEAK nay Shepherd to understand such pregnant wisdom.

Verses 4.9 to 4.10 of Svetasvatara Upanishad, expound that Brahman ( the field) is the hidden reality, nature is magic, Brahman is the magician, human beings are infatuated with the magic and thus they create bondage to illusions and delusions, and for freedom and liberation one must seek true insights and correct knowledge of the principles behind the hidden magic.

According to Bhagawad Geeta, a human being needs to be free from the delusion of the duality. Only after delusion of the duality is removed then only one can realize One Paramaatma

iccha-dvesa-samutthena

dvandva-mohena bharata

sarva-bhutani sammoham

sarge yanti parantapa-  Bhagawad Gita 4000 BC

O scion of Bharata [Arjuna], O conquerer of all foes, all living entities are born into delusion, overcome by dualities . Those who are so deluded by dualities are completely foolish and therefore cannot understand the Supreme Personality of Godhead.

The reason for the severity of such ignorance is spoken by Lord Krishna with the words sarva bhutani sammoham meaning all forms of life are completely deluded. At one's very birth when the physical body comes into existence the delusion begins due to the influence of dualities.

A human being need to lift the veil of delusion. The delusion is about duality. The soul is a part of brahmAn.

YeShaam Tu Antagatam Paapam

Janaanaam PuNya-KarmaNaam 

Te Dvandva Moha NirmuktaaH

Bhajante Maam DruDha-VrataaH  --  Bhagawad Gita 4000 BC

But those men of virtuous deeds, whose sins have come to an end, who are freed from the delusion of the pairs of opposites; worship Me by remaining steadfast in their resolve.  But they who worship me in every way are selflessly engaged in good deeds, free from sin and delusion, arising from the conflicts of attachment and repulsion, and of firm intent.

The very beginning of creation gave rise to the law of duality—the law of relativity necessary to divide the One into the many. By the storm of vibration, God's thoughts of multiplicity brought forth the waves of manifestation: His lila, or divine play. Objects in the phenomenal world are called relative because they exist only in relation to each other. Man's ordinary consciousness is relativity consciousness —i.e., he apprehends one thing only by interpreting it relative to something else. He cannot perceive the One, the Absolute, through that relative consciousness; it was given to him in order to appreciate the nature of the many.  Ordinary waking consciousness, subconsciousness, super-subconsciousness—all forms of ego consciousness—share this characteristic: they are relative. The pure superconsciousness of the soul can apprehend Spirit, the Life and Substance underlying and pervading everything in the universe. This Unmanifested Absolute cannot be described except that It was – ( Delusion arises from the duality of attraction and aversion, Arjuna; every creature is deluded by these from birth.Bhagawad Gita )

yadrccha-labha-santusto

dvandvatito vimatsarah

samah siddhav asiddhau ca

krtvapi na nibadhyate- Bhagawad Gita , 4000 BC

He who is satisfied with gain which comes of its own accord, who is free from duality and does not envy, who is steady both in success and failure, is never entangled, although performing actions.

The liberated Yogi can participate in any kind of action without being disturbed by the duality of the material world..  He is  above duality because he does not hesitate to act in any way.  Therefore he is steady both in success and in failure. These signs are visible when one is fully in transcendental knowledge.

In this world of relativity, nothing is exactly the same as it was a moment ago. It is said that one cannot bathe twice in the same stream. Everything in the universe is a stream of relativity that is in perpetual flux. In even inert objects, the constituent atoms are in constant motion, and some decay or change is taking place.  We are here today, tomorrow we are gone, mere shadows in a cosmic dream. But behind the unreality of these fleeting pictures is the immortality of Spirit. This world is a world of maya, delusion, and man is kept hypnotized with that delusion. This is the leela of God.

Duality is set equal to opposites, however there is no opposites, but only less or more of!

The TRINITY ( Brahma/ Vishnu/ Shiva ) causes and controls Maya. If Maharishis Dayanand shunned the cosmic forces of trinity he knows SHIT about Maya.  If he knows SHIT about Maya , he knows SHIT about Sanatana Dharma.

The ancient Vedic scriptures declare that the physical world operates under one fundamental law of maya, the principle of relativity and duality. God, the Sole Life, is an Absolute Unity; He cannot appear as the separate and diverse manifestations of a creation except under a false or unreal veil. That cosmic illusion is maya. Every great scientific discovery of modern times has served as a confirmation of this simple pronouncement of the ancient Maharishis.—Brahman satyam jagat mithya: "Brahman is real. His manifestation is unreal". A shadow cannot be produced without an object; therefore the shadow is not nothing! The shadow appears to be like the object from which it is produced, yet it is not the object. To rise above the duality of creation and perceive the unity of the Creator was conceived of as man's highest goal.

Those who cling to the cosmic illusion must accept its essential law of polarity:  flow/ ebb,  rise/ fall,  day/ night,  evaporation/ condensation,  pleasure / pain,  good / evil,  birth/ decay,  freezing/ melting,  potential energy/ kinetic energy,  attraction/ repulsion,  north pole / south pole,  acid/ base, positive pole/ negative pole,  clockwise vortex/ anticlockwise vortex,  sleep/ wake,  energy / matter,  static/ dynamic,  proton/ electron,  cathode / anode,  open/ shut etc. 

The only constant on the planet is change, everything is in a state of flux, nothing is static-- everything is vibratory.  This is what guarantees growth and evolution. It is a cosmic spiraling dance of  separate opposing forces, which sustains this universe. A yogi understands the story of the six blind men and the elephant. No life is possible on earth without this subtle tension . Yang elements are clear and obvious while Yin elements are subtle or hidden behind the quantum screen.. What has a front has a back-- what has a beginning has an end. It is a perfect tango of dynamic balance where one polar opposite changes into another smoothly and constantly . If the restraining balance or equilibrium is lost , the universe will spiral out of control and end. This principle of Dvaita Hinduism -- Tamas Rajas , which are rooted together , is present in every phenomenon on earth., where energy transforms from one to another—it can neither be created or destroyed. These two opposing forces are natural and transform each other , in perfect harmony.  Harmony can never be stagnant .  Lessening of Tamas always results in increase of Rajas and vice versa.. One cannot exist without the other and they are dependant .  No phenomenon in this universe is completely devoid of its opposite.  They consume each other yet support each other.Whatever is in excess gets reduces, whatever is deficient gets replenished. Balance can never be permanent— Tamas and Rajas continiously devour each other – and life flows on. Delusion divides, measures out, the Undefined Infinite into finite forms and forces. The working of cosmic delusion on these individualizations is called avidya, individual illusion or ignorance, which imparts a specious reality to their existence as separate from Spirit.  Spirit alone is perfect. Everything in creation, being delimited, is imperfect.

The soul was born with the stars , it can never die. Birth and death have meaning only in the world of relativity. Life and death are relativities of thought only. Vedanta points out that God is the only Reality; all creation or separate existence is maya or illusion. The consciousness of the unenlightened person is blinded by four successive veils of maya, delusion, which prevent him from perceiving Truth or God.  From their very birth children are exposed to cosmic delusion and grow up helplessly under it. God gives them delusion first, and not Himself, in order to carry on His dramatic scheme of creation. –his leela . If He did not cover Himself with the veils of maya, there could be no Cosmic Game of creation, in which men play hide-and-seek with Him and try to find Him as the Grand Prize. There would  no soul evolution. There would be no feed back loop where soul merges with the mother field of brahmAn after moksha and downloads its individual experience, gleaned over  thousands of re-births  , which causes brahmAn to know everything. Time is often referred to as the fourth dimension, along with the three spatial dimensions , the concept of time depends on the spatial reference frame of the observer. Time dilation which made THIEF Einstein famous is stolen from the Vedas. We all know that pleasure and action make the hours seem short. Have you not hidden and tried to have a glimpse of your sweetheart , or spent long time over a creative favourite hobby ?  This is because heart knows neither duality nor the limitations of space and time.  Time is in essence a grand illusion that has taken a hold of our consciousness and conditioned our reality to believe in it, thus we then become enslaved by the illusion and suffer the karmas associated with it. In the Singularity of Source, there is no time - only an Infinitely Conscious Presence of Being that exists in all forms and all spaces at once. As one comes to recognize Source, one is freed from the bonds of time and all karmic causality is destroyed. In the Immortal Timeless Presence of Source - the past (or the future!) have no power and one becomes a Karma Immune Being. This is an extremely powerful vibratory state to exist in and by residing here one is free from ALL conditionings, delusions, illusions and cycles of time. Karma no longer has power over one because the Law of Cause and Effect needs a temporal (time) bubble to exist within. Outside of time, nothing can precede anything or condition any future moment, for there is no future to affect. In the same vein, the energy of the past peels away from one's being and becomes nothing. The causal links between the past and the present are severed, thus no karma can possibly ripen or even exist in the Timeless State. As for the redemption and forgiveness of karma, the embodiment of Source Presence is the most powerful - and ultimately the only real mechanism behind karmic cleansing. The mind in the 3rd dimension cannot perceive directly the Timeless Singularity of Source, for the mind exists within duality, and within duality all things appear distinctly separate.  In order to perceive all of these distinctively separate phenomena, the mind projects a 'holding space' for these phenomena called space-time. The space aspect creates a medium for distinguishing everything and providing a contrast between one phenomenon (object, sound, smell or any other kind of sensation) and another.   3-dimensional space has no inherent reality of its own and cannot be perceived to exist as a 'stand-alone' phenomenon. It always requires some kind of phenomena so as to be distinguishable. The construct of space allows the mind to see where one form ends and another begins. Man should realize the ethereal nature of his being—made of light and consciousness, divine and indestructible, projected on the screen of time and space by the creative Cosmic Beam of God. In Spirit there is no past or future, only the everlasting Present. It is in the relativistic consciousness of persons under the influence of maya that Eternity appears separated into past, present, and future. God always is, and His immortal omniscience is not compartmentalized by the dimensional delusions of time and space; He beholds everything as happening in the infinitude of His Being now. Human consciousness is limited by the threefold relativity of time— past, present, and future. Man usually forgets past happenings, has consciousness of the present incidents in his life, and is unaware of the future. But God's consciousness is ever aware throughout eternity. Divine consciousness has no past, no future, because it is never interrupted, like man's, by death or limitation. Bhagawad Gita tells us that eternal consciousness has one time—the ever present. God looks through the window of infinite consciousness on the films of finite happenings of the past, present, and future shown on the screen of time and space, continuously moving backward and forward in an eternal now.Maya or avidya can never be destroyed through intellectual conviction or analysis, but solely through attaining the interior state of nirbikalpa samadhi. ...  Nirvikalpa ("without difference") samadhi is the highest yoga or union manifested by fully liberated masters or those on the threshold of soul freedom. There are two manifestations of the darkness of delusion: one is maya, cosmic delusion, "that which measures the Infinite"; and the other is avidya, which means ignorance or individual illusion.. Maya is the mass hypnosis of God by which He makes every human being believe in the same illusory "reality" of creation as perceived by the senses; avidya gives individuality of form, experience, and expression (it supports the ego or I-consciousness). Man's essential nature is formless omnipresent Spirit. Compulsory or karmic embodiment is the result of avidya, ignorance. The Hindu scriptures teach that birth and death are manifestations of maya, cosmic delusion.Again duality is the state of separation from Oneself (Reality, Supreme conscious, God). The face you see in the mirror is not you—it is like the shirt your wear. YOU are the soul within you, a part of brahmAn sent to earth to evolve and gain experience. When one is separated from oneself, he goes into deep sorrow, depression, despondency and dilemma and his mind is filled with doubts, emotional conflicts, anger and fear. Due to these negative emotions, he becomes both physically and emotionally weak and loses his capability to cope with challenges in day to day life and feels lost. In the path of duality, one thinks that God is separate from him (duality) and tries to attain God-Realization through complex and meaningless external means , most of them add to the karmic baggage , instead of reducing it  

One develops attachment to sense objects by thinking about them. From attachment arises desire for them. From unfulfilled desires comes anger. From anger comes delusion; from delusion confusion of memory; from disappearance of memory and a bewildered mind; reasoning (discrimination) is destroyed. When reasoning is destroyed, one falls from right path. (Bhagawad Gita. 2.62-63)

Those who are free from egoism (Arrogance, I-ness) and delusion, who have conquered the evil of attachment, who are totally free from selfish desires and dualities like pleasure and pain and dwelling constantly in the Supreme-Self, such delusion–free ones attain the Supreme state, Oneness with God, Sat Chit Ananda (Eternal Goal). ( Bhagawad Gita. 15.05)

The Bhagavad Gita, gives a step by step method to develop non-duality/Oneness though self-discipline, self-awareness, self-purification and self-transformation. Practice of non-duality helps to develop good health, mental peace and freedom from miseries in the material world and beyond. Not only does one develop eternal happiness and peace, one also enjoys his life to the fullest and attains the purpose of his existence, and contribute to society and bring happiness and peace to others.

Maya stands for anything that has real, material form, human or non-human, but that does not reveal the hidden principles and implicit knowledge that creates it. The Upanishads describe the universe, and the human experience, as an interplay of Purusha (the eternal, unchanging principles, consciousness) and Prakṛiti (the temporary, changing material world, nature). The former manifests itself as atman (Soul, Self), and the latter as Maya. The Upanishads refer to the knowledge of Atman as "true knowledge" (Vidya), and the knowledge of Maya as "not true knowledge" (Avidya, Nescience, lack of awareness, lack of true knowledge). Maya pre-exists and co-exists with Brahman – the Ultimate Principle, Consciousness. Maya is perceived reality, one that does not reveal the hidden principles, the true reality. Maya is unconscious, Atman is conscious. Maya is the literal, Brahman is the figurative Upadana – the principle, the cause. Maya is born, changes, evolves, dies with time, from circumstances, due to invisible principles of nature, state the Upanishads. Atman-Brahman is eternal, unchanging, invisible principle, unaffected absolute and resplendent consciousness. Maya concept in the Upanishads, is "the indifferent aggregate of all the possibilities of emanatory or derived existences, pre-existing with Brahman", just like the possibility of a future tree pre-exists in the seed of the tree.

The Soul is imagined first, then the particularity of objects,

External and internal, as one knows so one remembers.

As a rope, not perceived distinctly in dark, is erroneously imagined,

As snake, as a streak of water, so is the Soul (Atman) erroneously imagined.

As when the rope is distinctly perceived, and the erroneous imagination withdrawn,

Only the rope remains, without a second, so when distinctly perceived, the Atman.

When he as Pranas (living beings), as all the diverse objects appears to us,

Then it is all mere Maya, with which the Brahman (Supreme Soul) deceives himself.

— Gaudapada, Māṇḍukya Karikā 2.16-19

Maya, Sarvasara Upanishad defines Maya as all what is not Atman. Maya has no beginning, but has an end. Maya, is anything that can be studied and subjected to proof and disproof, anything with Guṇas. In the human search for Self-knowledge, Maya is that which obscures, confuses and distracts an individual.

Just as when the dirt is removed, the real substance is made manifest; just as when the darkness of the night is dispelled, the objects that were shrouded by the darkness are clearly seen, when ignorance [Maya] is dispelled, truth is realized.

— Vashistha, Yoga Vasiṣṭha

A primary cause of suffering is delusion: our inability, because of a subtly willful blindness, to see things the way they truly are but instead in a distorted way. The world a seamless and dynamic unity: a single living organism that is constantly undergoing change. Our minds, however, chop it up into separate, static bits and pieces, which we then try mentally and physically to manipulate, powered by EGO. One of the mind's most dear creations is the idea of the person and, closest to home, of a very special person which each one of us calls "I": a separate, enduring ego or self. In a moment, then, the seamless universe is cut in two. There is "I" -- and there is all the rest. That means conflict -- and pain, for "I" cannot control that fathomless vastness against which it is set. The very beginning of creation gave rise to the law of duality—light and darkness. By the storm of vibration, God's thoughts of multiplicity brought forth the waves of manifestation: His lila, or divine play. Objects in the phenomenal world are called relative because they exist only in relation to each other. Man's ordinary consciousness is relativity consciousness —i.e., he apprehends one thing only by interpreting it relative to something else. He cannot perceive the One, the Absolute, through that relative consciousness; it was given to him in order to appreciate the nature of the many. Ordinary waking consciousness, subconsciousness, super-subconsciousness—all forms of ego consciousness—share this characteristic: they are relative. The pure superconsciousness of the soul can apprehend Spirit, the Life and Substance underlying and pervading everything in the universe. This Unmanifested Absolute cannot be described except that It was the Knower, the Knowing, and the Known existing as One. In It the being, Its cosmic consciousness, and Its omnipotence, all were without differentiation: ever-existing, ever-conscious, ever newly joyous Spirit. In this Ever-New Bliss, there was no space or time, no dual conception or law of relativity; everything that was, is, or is to be existed as One Undifferentiated Spirit.. Thus, Spirit first gave rise to a Magic Delusion, Maya, the cosmic Magical Measurer, which produces the illusion of dividing a portion of the Indivisible Infinite into separate finite objects. Through the power of maya, cosmic illusion, the Creator has caused the manifestations of matter to appear so distinct and specific that to the human mind they seem unrelated in any way to Spirit. The phenomenal world operates under maya, the law of duality or oppositional states; it is thus an unreal world that veils the truth of the Divine Oneness and Unchangeableness. When a yogi awakens in soul consciousness all dualities disappear and he knows himself as the eternal and blissful Spirit.When one realizes oneself, one realizes the essential nature of the universe. That the existence of duality is only an illusion and when the illusion is undone, the primordial unity of one’s own nature and the nature of the universe is realized, or made real.  Non-duality (Advaita) is the philosophical, spiritual, and scientific understanding of the non-separation and inherent Oneness with the Supreme. It refers to the identity of the Self (Atman) and the Whole (Brahman). What is matter? Nothing but a particular rate of vibration of God's cosmic energy. No form in the universe is really solid. That which appears so is merely a compact or gross vibration of His energy.  The scientifically indisputable truth that matter is in reality a concentrate of energy.  Man thinks of his mortal form as solid flesh and bone. That is a concrete delusion. The body is an amalgam of countless infinitesimal subatomic particles; these particles are made up of finer-than-atomic lifetronic energy and ultimately of thoughtrons, sparks of consciousness whose source is Cosmic Consciousness. Everything existing in nature is energy in a more or less compact stage of vibration, exhibiting weight according to its mass or distinguishing gravitation. The seemingly solid body is itself a nonmaterial electromagnetic wave made up ultimately of underlying astral lifetrons, which in turn are made of Cosmic Consciousness. God has ingeniously condensed His consciousness into lifetrons, lifetrons into electrons and protons, these subatomic particles into atoms, and atoms into molecules and cells—all of which live by radiations from the Cosmic Source. Delusion divides, measures out, the Undefined Infinite into finite forms and forces. The working of cosmic delusion on these individualizations is called avidya, individual illusion or ignorance, which imparts a specious reality to their existence as separate from Spirit. Spirit alone is perfect. Everything in creation, being delimited, is imperfect--even as a calm ocean becomes distorted into individual waves on its surface by the action of a storm.

“ O Arjuna, transcends these Gunas, free yourself from duality (pairs of opposites), be unconcerned with acquisition and preservation and be established in purity (Supreme-Self) with your mind under full control.” (Bhagawad Gita. 2.45)

The self disciplined person, who has control over the lower self (mind, senses and body) and remains firmly established in the Supreme-Self, has attained tranquility and everlasting peace. Such a person is always balanced in heat and cold, in pleasure and pain, and also in honor and dishonor (duality). (Bhagawad Gita.6.07)

The Spiriual ScientistJuly 31, 2016 at 6:24 PM

He is the man with the highest longevity,perhaps at his moment.120 years.

http://timesofindia.indiatimes.com/city/kolkata/120-year-old-found-fighting-fit-after-1st-check-up-in-life/articleshow/53472762.cms?utm_source=facebook.com&utm_medium=referral&utm_campaign=TOI&from=mdr

1. Capt. Ajit VadakayilJuly 31, 2016 at 6:44 PM

   hi tss,
   
   HOW DID BHISHMA DIE AT THE MOMENT HE CHOSE ?
   
   DUSK TIME ON MAKARA SANKRANTI
   
   THIS IS THE EXACT TIME OF THE THREE FLASHES AT SABARMIMALA
   
   IT WAS A YOGA TECHNIQUE OF BREATHING TAUGHT BY SHIVA TO PARVATI --  PART OF VIGYANA BHAIARAVA TANTRA
   
   WE HAD CHETAN BHAGAT RIDICULING BABA RAM DEV ABOUT YOGA CURING HOMOSEXUALITY
   
   WELL WHAT DOES THAT MENTAL MIDGET KNOW?
   
   A YOGI WHO KNOWS THE SECRETS OF IDA / SUSHUMNA/ PINGALA BREATHING CAN EVEN CHOOSE THE GENDER OF HIS CHILD.
   
   HE THINKS HE IS THE CATS WHISKERS BECAUSE NEW YORK TIMES CALLED HIM THE NO 1 BEST READ WRITER IN INDIA?
   
   WELL , CHETAN BHAGATs TOTAL LIFE TIME SALES IS JUST TWO WEEKS VIEW COUNT FOR THIS BLOGSITE
   
   capt ajit vadakayil
   ..

THIS POST IS NOW CONTINUED TO PART 59, BELOW--

http://ajitvadakayil.blogspot.in/2016/07/sanatana-dharma-hinduism-exhumed-and_31.html

CAPT AJIT VADAKAYIL
..