Friday, July 29, 2016

SANATANA DHARMA , HINDUISM EXHUMED AND RESURRECTED, PART 57 - CAPT AJIT VADAKAYIL



THIS POST IS CONTINUED FROM PART 56, BELOW-





NONE OF THE SO CALLED ANCIENT CIVILIZATIONS OF THE PLANET HAVE LEFT BEHIND ANYTHING OF CEREBRAL VALUE IN WRITING-- ABSOLUTELY  NOTHING !!     

80% OF OUR VEDAS ( SAMHITAS/ BRAHMANAS/ ARANYAKAS/ UPANSIHADS) HAVE BEEN STOLEN / DESTROYED BY THE WHITE INVADER.    

THE JEALOUS WHITE MAN  POST DATED OUR ANCIENT WORKS PENNED DOWN IN 5000 BC,   TO SUIT THEIR UNDERSTANDING OF BIG BANG DATED AT A RIDICULOUS 4004 BC.    

IN THIS INTERNET AGE, IT IS PAY BACK TIME !   


THE WORLD SHALL KNOW THE GLORY OF ANCIENT INDIA  !! 




CHECK OUT THE SOUND OF  PATANJALIs YOGA SUTRAS PENNED DOWN 7000 YEARS AGO, WHEN THE REST OF THE WORLD WERE RUNNING AROUND NAKED DOING GRUNT GRUNT




CHAPTER I-  SAMADHI PADA-   CONTEMPLATION
atha yoganushasanam
yogashchittavrittinirodhah
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pramannaviparyayavikalpanidrasmritayah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
vitarkavicharanandasmitaroopanugamatsanprajnatah
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tajjapastadarthabhavanam
tatah pratyakchetanadhigamopyantarayabhavashch
vyadhistyanasanshayapramadalasyaviratibhrantidarshanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah
duhkhadaurmanasyanggamejayatvashvasaprashvaavikshepasahabhuvah
tatpratishedhartham ekatattvabhyasah
maitreekarunamuditopekshanansukhaduhkhapunyapunyavishayananbhavanatashchittaprasadanam
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
ksheennavritterabhijatasyevmanergrahitrigrahannagrahyeshutatsthatadangjanatasamapattih
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih

CHAPTER II - SADHANA PADA-- PRACTISE

tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
anityashuchiduhkhanatmasunityashuchisukhatmakhyatiravidya
drigdarshanashaktyorekatmatevasmita
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
dhyanaheyastadvrittayah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
samadhisiddhirishvarapranidhanat
sthirasukham aasanam
prayatnashaithilyanantasamapattibhyam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah

CHAPTER III – VIBHOOTI PADA - MANIFESTATION

deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
sarvarthataikagratayoh
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
parinamatrayasanyamadatitanagatajnanam
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
sthoolasvaroopasookshmanvayarthavattvasamyamadbhootajayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti

CHAPTER IV--  KAIVALYA PADA --  LIBERATION

janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
nirmannachittanyasmitamatrat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
chiterapratisankramayastadakarapattausvabuddhisanvedanam
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah

purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti



2.44— svadhyayad ishtadevatasanprayogah


Self-study leads towards the realisation of God or communion with one's desired deity. 




The word "ishta" means desired or preferred and "devata" means a deity. Ishta Devata thus refers to one’s deity of choice. The ishta devata deity can be visualized when a mantra to the deity is chanted with total devotion and ardor. The necessity to visualise God as an object, or an ishta devata, arises on account of the difficulty of the mind in transcending space and time ( mere Sanskrit language knowing halfwit indophiles wont understand quantum physics inherent in Vedas) . Halfwits cannot understand this concept. In Hinduism we are given a free choice on what we want to focus our mind on . We are not armtwisted to focus our mind on a man bleeding to death on a cross. Muslims make fun of Hindus as being idol worshippers. What do they know ?  Allah is a straight lift from brahmAn.  Ishta Devta can be find out from your horoscope alone. Though in modern times ishtadevata is your free choice.The ishta devata becomes, for our purposes, a conceptual ideal that we have placed before us, on which we foist all the greatest qualities of God. We consider the ishta devata as an all-pervading essence concretised in one form.  Shallow minded people who do not understand the essense of meditation , will never understand why Hindus worhsip idols, though our god is brahmAn ( the morphogenetic consciousness field ) which cannot be picked up by the 5 senses . Kula Devata is the God/Goddess worshipped by the family, by tradition. This Kula Devata is the God to whom the family would do prayer before any auspicious occasion is done at home: like marriage, upanayan sanskar etc. Kula Devata cannot be substituted by Ishta Devata as Ishta Devata can be specific to each person, even in a family.  Ishta Devata is the personal Deity who will guide the soul to its real home- Moksha. You need to necessarily search through your aged relatives to find the Kula Devata.An ishta devata is our own God, whom we worship and adore.  Though theoretically it is conceded that God is everywhere, the mind cannot conceive this everywhereness.  Even when we agree that God is everywhere, the idea of God being everywhere will be a kind of externalisation of form. Even if we think of God as the universal Virat Himself, when we think of the Virat, He will appear to be an object which we are cognising.  Remembering the deity and internally building a relationship with (or through) them is considered essential to the yogic practise. Within the Advaita schools it is held that the human mind needs a concrete form to understand the divine that ultimately can never be defined. Just as one can understand the abstract concept of a color only after one has seen a concrete form, one can only realize the deity through a form of murti.  The advaita god of brahmAn cannot be picked up by the 5 human senses.The immoral white invader used this Ishta devata concept to drive wedges. They made devotees of Vishnu and Shiva fight and abuse each other using the FAKE and backdated mutts. Hindus must know that the TRINITY works in tandem and in harmony.  Typically a practitioner worships their Ishta-Deva through the form of a murti. This worship may involve offering items while in a grateful disposition to their chosen divinity such as incense or flowers, reciting mantras, singing their names and offering prayers. Mantra sadhana done with faith and intensity leads to ishta devata samprayogah, which means that the ishta devata appears before the sadhaka in a human form, a sound vibration or a light.Svadhyaya has been mentioned twice in the sutras, first in sutra 2.1 as part of Kriya Yoga and later on as one of the five niyamas. Since the practice of Svadhyaya brings one face to face with their deity of choice, it means that the practicing yogi is expected to have an ishta-devata. Though consciousness survives within the body, it needs to be knocked by the practice of yoga asana and pranayama, wherein the intelligence acts as a bridge to connect awareness of the body with the core and vice versa. This connecting intelligence alone brings harmony of body, mind and soul, and intimacy with the Supreme Soul (Istadevata). Traditionally, svadhyaya has been explained as the study of the sacred scriptures and recitation mantra, through which the sadhaka earns a vision of his tutelary or chosen divinity, who meets each of his wants.  Svadhyaya is the study of scriptures and also practicing our individual sadhana (spiritual pursuit) that we have been initiated into. Through this practice we can get a "darshan" or a vision of our own deity of choice. Every mantra that we chant is usually identified with a deity and through intense sadhana, the deity may appear in human form or in the form of light or a sound.  Svadhyaya literally means self-study but also refers to study of sacred texts. In Vedic times, it involved recitation of vedic hymns until memorized. OM has been referred to as the representative sound for Ishvara (sutra 1.27), it is apparent that Patanajli is referring to Ishvara and its manifest forms as ishta devatas.  When we surrender to God, we essentially become free of material possessions and thus free of any worries. This leads us to an attitude of detachment which is a requirement for the state of Samadhi. Samadhi means tranquility of mind which is achieved when we dedicate everything to God and are free of attachments.Of all the attainments mentioned in the sutras which result from practicing the various yamas and niyamas, it is only through the practice of Ishvara-pranidhana that samadhi, the goal of yoga, can be attained.  As we recall, in sutra 2.1, Ishvara-pranidhana is mentioned as a part of Kriya Yoga, and now again it is mentioned as one of the five niyamas. Even though in chapter 1 on Samadhi Pada, Ishvara-pranidhana was mentioned as one of the options to attain peace of mind. However, in chapter 2, Patanjali makes it a requirement if we want to follow the eight limbs of yoga. The ultimate goal of yoga is realization of atman (individual soul) as a part of brahmAn, the mother field. In the Bhagavad Gita, Arjuna asks Krishna as to which of two paths is superior – the path of knowledge based on the imperishable, unmanifest or the path of devotion (shloka 12.1). Krishna states that even though one can attain liberation using the former path, but that path is difficult to follow. He adds the one following the path of devotion is the best among the yogis.Even though Patanjali’s main focus is calming the mind and realization of brahmAn, he has given ample evidence of the use of bhakti (devotion) as a means to that attainment.
Svadhyayam is the exercise of the self, by the self, and for the self as in exercises at the end of chapters in technical textbooks. Aspects of the phenomenal universe as apprehended are exercised through the model of the cognitive process. The three fundamental questions are 1) how do I happen to be aware of this now?, 2) why does it appear to me in this way instead of another way?, and 3) what about me that latches on to this particular manifestation?  The phenomenal universe is surrendered to Ishvara who will present the impression of the undifferentiated subject to a clear mind. When one experiences who the subject is one is distanced from the body which feels pain and suffering.The following five points emerge regarding the meaning, sadhana and outcome of swadhyaya:-- Study of scriptures, Study of one’s own self, Mantra japa, Some form of meditation practice, Attainment of the ishta devata..The study of sacred scriptures such as Bhagavad Gita constitute a great aid to sadhana. A broad intellectual background is necessary for achieving success in any sphere of scientific endeavour. Since yoga is a science par excellence, this is also true of yoga. This part of swadhyaya, however, is only the first step. Constant introspection on the fundamental truths and deeper problems that have been studied is more important. This constant reflection gradually and imperceptibly begins to take the form of meditation in the ordinary sense of the term, i.e. the mind becomes increasingly engrossed in the object of the search. Thus it slowly becomes ready to receive real knowledge from within and the aspirant begins to obtain a deeper insight into the problems of yogic life. The scriptures are meant not only for rational, intellectual, logical understanding. The value of their teaching lies in being able to apply what we have understood in everyday life. Our study will have no benefit if we do not make an effort to live up to the teachings.   Practical application of material suitable for our temperament and relevant to our mode of life is necessary if we wish to derive any permanent, substantial benefit from our study. Studying the scriptures does not mean just scanning the pages, but trying to understand every word, studying with heart. The more often we read, the more we understand. We see things in a new light. That is the greatness of the holy scriptures. We gradually rise upwards. This implies elevation of the mind and expansion of its horizon, which further implies a better understanding of everything within and around.  We are attuned to the authors who were realized souls, great saints, seers and gurus who trod the path of truth, and encountered and removed difficulties. Thus they give us hope and vigour. Daily reading is one of the most powerful methods of keeping the mind fully alive to one’s ideal. A host of powerful, positive ideas rushes to the mind and the mental powers are at once sharpened. The reader is inspired and uplifted, and enabled to conquer the lower forces in everyday life. Therefore, a sadhaka should not give up swadhyaya, even for a single day.  By reading inspiring sentences over and over again, they become indelibly engraved in the heart and a part of one’s inner nature. Such repetition gives strength and pushes an idea into the innermost chambers of the heart and mind. Then the idea percolates into the subconscious mind. As a result, the negative thoughts lurking there are gradually annihilated.  Spiritual books like Bhagawad Gita  act as consoling companions under all vexing circumstances, ideal teachers in all difficulties, as a guiding light in the nights of nascence and folly, as a panacea for evils and as shapers of destiny.Witnessing yourself and studying one’s own personality is another equally valid and widely accepted view of swadhyaya. This implies the ability to read one’s life like a book, to be aware of each and every page. In other words, it is the analysis of our own personality, being aware of our individual qualities, strengths and weaknesses, in order to know what and who we are.  Introspection and self analysis is useful only if translated into action.  A yogi will not cheat himself during self analysis.  He can fail himself.  Self reflection for a yogi is a humbling process. Always use adversity to introspect. These are god given opportunities to drive real change. The heart and mind of a person can be understood by knowing what he aspires to be-  not what he is or what he was.  There is only one thing in this cosmos which you can be cock sure is bringing change to yourself with self discipline. The other is death. Everything which irritates us about others can lead to an understanding of ourselves. Your current comfort zone and safe boundaries were once unknown frontiers. You can take off your clothes and show yourself to a whore. This is not the real opening up. Rather opening up is about revealing your soul  ( dreams, thoughts, fears  etc )— this is the true meaning of being naked. Swadhyaya is a process of witnessing our own consciousness. Swadhyaya implies continually watching our actions and reactions in different situations, circumstances and events with more awareness. We should try to know the reasons for our happiness and sorrow, anger, greed and attachment. As a result, we will gradually find out how our mind works and will become more aware of the things that disturb our mind.  With an understanding of our weaknesses in particular, we can chart out a multi-faceted program to weed them out, and thus prepare the ground for our gradual upliftment. Thus this type of self-analysis is of great value in our life.Mantra repetition is a swadhyaya because it helps to explore the inner recesses of consciousness. Such a sadhana harmonizes the lower vehicles of consciousness, makes them sensitive to the subtle vibrations, and ultimately brings about a partial fusion of the lower and higher consciousness.  Each mantra has a deity, or a name and form.   Every Suryanamaskara asana pose has its own mantra.  Mananat trayate iti mantrah is the definition of mantra. It means that as a result of regular and intensive mantra sadhana, the distractions, deviations, fluctuations, turbulence and disturbances of the mind slowly cease. The mind is relatively harmonized, calm and quiet. Such a mind is capable of focusing, looking within, and communing with the inner nature. Another relevant view of swadhyaya relates to meditation experiences. Accordingly, if an aspirant sees visions in meditation, he should let them come. They should not be suppressed as they will tell the aspirant a lot about the things that are embedded in the subconscious mind: memories, deep-rooted problems, etc. Many may be causing persistent problems without the aspirant’s knowledge. By conscious observation, the aspirant may easily face them and get rid of them. In the context of meditation, swadhyaya also means closing the eyes and observing one’s own self, as is done in antar mouna practice. This gives rise to a faculty by which one is able to focus deeply on the god or goddess of one’s choice. Meditation, as understood in the usual sense of the term, may also be regarded as swadhyaya. When we meditate on a mantra, an image or a thought, an abstract form or the formless, this is swadhyaya. This type of meditation deepens our understanding and brings us closer to our nature.  Self-analysis is a great tool of jnana yoga. It can be concluded that if these approaches and techniques are practised with faith, sincerity and regularity, and under the right guidance, they will lead to mental peace, emotional harmony and bring the aspirant closer to the inner nature. Ishta devata darshan, or experience of the self, will not remain too distant a goal.  Swadhyaya is the practice of self-study and self-analysis.  Sva is interpreted as ‘self’ and adhyaya means ‘investigation or inquiry’.  Yogis, we are encouraged to self-inquire daily through practices such asana, pranayama and meditation.  Traditionally, swadhyaya is attributed to the study of sacred texts.  According to Patanjali, in order to attain a greater understanding of one’s true being, the study of scriptures is important.  The scriptures are used to assist one in engaging in life spiritually through self-inquiry.We can often go through life without looking deeply within ourselves, our values, actions and the impact we have on others by our thoughts, words and actions.  The yogi is encouraged to engage in self-reflection by analysing the impact they have on others.  You may think you come to yoga to build fitness and build strength and flexibility; which of course is true; however, through these practices we are engaging in the act of swadhyaya.  We flow through postures using breath and movement, building concentration… we scan the body, we bring our awareness to our breath, we still the mind…all practices of self-reflection.  By doing this, we get to know ourselves more honestly and see ourselves for what we are, not who we think we are.  Svadhyaya inspires and elevates the mind to high spiritual altitude. It clears doubts. It weeds out unholy ideas. It cuts new spiritual grooves for the mind to move on. It reduces wandering of the  mind or Vikshepa. It helps concentration. It forms a kind of lower Savikalpa Samadhi. It serves pasture for the mind to graze upon. When you study the sacred books, you are in tune with the authors who are realised souls. You draw inspiration and become ecstatic. Svadhyaya clears doubts. It  strengthens the flickering faith, it induces aspiration or strong yearning for liberation. It fills the mind with Sattva  or purity; it inspires and elevates the mind. It helps concentration and meditation. It cuts new Sattvic grooves and makes the mind run in these new grooves. To translate the precepts contained in the books of the sages and saints into action is to have your afflicted body soothed, to have your bruised soul healed, and to save yourself from all kinds of ills of life which are due to ignorance. Spiritual books act as consoling companions under all vexing circumstances, as ideal teachers in all difficulties, as guiding lights in the nights of nescience and folly, as panacea for evils and as shapers of destiny. Acquire wisdom by digesting the books of sages and saints, philosophers and mystics. By wisdom, master the secrets of all sciences, know the exact nature of things, tune your localized being or individualised personality with the workings of the divine nature of the Laws of Truth. Wisdom is the key to the plenitude of power and joy. Wisdom annuls countless sufferings, innumerable sins, cuts the root of ignorance, and confers upon you peaceful harmony and absolute perfection





Someone asked me about mind and space time. 

The mathematical space-time model that joins space and time into a single idea called a continuum was written in Vedanta 7000 years ago.

German Jew Albert Einstein lifted from it and made himself famous.   Wherever an important quantity of matter exists, it bends the geometry of spacetime.  

THIEF  Einstein wrote that space and time are relative -- an object in motion actually experiences time at a slower rate than one at rest.

This is a direct lift from a Vimana travel story of King Kakudmi and his daughter Revati.


Let me quote Wikipedia-

QUOTE:  Kakudmi was able to take his daughter Revati with him and travel to Brahma-loka (the plane of existence where Brahma, the Creator, resides) and to speak with Brahma at will.

Meeting with Brahma[edit]

Kakudmi's daughter Revati was so beautiful and so accomplished that when she reached a marriageable age, Kakudmi, thinking no one upon earth was worthy of her, went to the Creator himself, Lord Brahma, to seek his advice about a suitable husband for his daughter.

When they arrived, Brahma was listening to a musical performance by the Gandharvas, so they waited patiently until the performance was finished. Then, Kakudmi bowed humbly, made his request and presented his shortlist of candidates. Brahma laughed loudly, and explained that time runs differently on different planes of existence, and that during the short time they had waited in Brahma-loka to see him, 27 catur-yugas (a cycle of four yugas, totalling 108 yugas, or Ages of Man) had passed on earth. 

Brahma said to Kakudmi, "O King, all those whom you may have decided within the core of your heart to accept as your son-in-law have died in the course of time. Twenty-seven catur-yugas have already passed. Those upon whom you may have already decided are now gone, and so are their sons, grandsons and other descendants. You cannot even hear about their names.[2] You must therefore bestow this virgin gem (i.e. Revati) upon some other husband, for you are now alone, and your friends, your ministers, servants, wives, kinsmen, armies, and treasures, have long since been swept away by the hand of time."[3]

King Kakudmi was overcome with astonishment and alarm at hearing this news.[3] However, Brahma comforted him, and added that Vishnu, the preserver, was currently incarnate on earth in the forms of Krishna and Balarama, and he recommended Balarama as a worthy husband for Revati.

Kakudmi and Revati then returned to earth which they regarded as having left only just a short while ago. They were shocked by the changes that had taken place. Not only had the landscape and environment changed, but over the intervening 27 chatur-yugas, in the cycles of human spiritual and cultural evolution, mankind was at a lower level of development than in their own time (see Ages of Man). The Bhagavata Purana describes that they found the race of men had become "dwindled in stature, reduced in vigour, and enfeebled in intellect."

Daughter and father found Balarama and proposed the marriage which was accepted. The marriage was then duly celebrated. UNQUOTE




Wherever an important quantity of matter exists, it bends the geometry of spacetime.   This results in a curved shape of space-time that can be understood as gravity. In classical mechanics, the use of spacetime is optional, as time is independent of mechanical motion in the three dimensions of Euclidean space. 

When a body is moving at speeds close to the speed of light (relativistic speeds), time cannot be separated from the three dimensions of space as time then depends on how close to the speed of light the object is moving.

The mind of a liberated jivan mukt can transcend space time. He has extended his consciousness into the infinite.

Ordinary folks like you and me can do it only during REM sleep. At about 70 to 90 minutes into your sleep cycle, you enter REM sleep. You usually have three to five REM episodes per night. Your eyes jerk rapidly in various directions under your eyelids, thus the name Rapid Eye Movement (REM) Sleep, where most muscles are paralyzed with occasional twitches.  This level is also referred to as paradoxical sleep because the sleeper, although exhibiting Beta EEG waves similar to a waking state, is harder to arouse than at any other sleep stage. Vital signs indicate arousal and oxygen consumption by the brain is higher than when the sleeper is awake.  There is shallow rapid breathing.  REM stage has increased heart rate, raised blood pressure, erection in males, and the body does not regulate its temperature. Most of the vivid dreams occur during REM sleep, once awaken at this stage a person can remember the dream. Adults spend  20% in REM. Older adults spend progressively less time in REM sleep. People are more likely to remember the dream if they are awakened during the REM phase. Males have an erection and females have enlarged clitoris during REM sleep.  However this is NOT because of thoughts of sex, sorry.  No matter what a dream is about, REM sleep will cause an erection in a man who is not impotent.   Even newborn boys have a boner during REM sleep!   The reason why men sometimes wake up with a hop is simply because they were having a dream when they woke up. In females, nocturnal clitoral tumescence or NCT is accompanied by vaginal blood flow and transudation ( lubrication ).   Twice the amount of blood flows to your brain during REM than when you are conscious. Unless a dream is particularly vivid and if one wakes during or immediately after it, the content of the dream is not remembered, unless you write it down immediately within a few seconds . Primarily REM is the brain's way of  ensuring that the consciousness can be “booted up”, in the absence of an external trigger. In the absence of external stimulus, the brain might stay in  deep sleep coma continuously until dehydration causes death.  Humans cannot go into hibernation.Non REM sleep restores our body physiologically , as when the body is at reast more cell division and repair happens..REM sleep restores us mentally.  REM sleep thus plays a huge role  in learning and memory. During REM sleep, your brain consolidates and processes the information you’ve learned during the day. REM has an UNLEARNING and  memory-consolidating function .  Some of these memories taken in by our senses may be rejected by the mind as useless, while others may be seen as valuable and retained.There is information exchange from the conscious left lobe ( for right handers ) to be sub conscious right lobe. Learned skills consolidate in the brain during the REM sleep. This is why after a brain storming session, the thoughts must be left to incubate till an REM sleep.  Major decisions are kept pending till then. REM has been shown to have links to memory consolidation and to learning. Adults who are deprived of REM sleep have trouble remembering and learning new things.  REM sleep stimulates the brain regions used in learning.  People taught a skill and then deprived of non-REM sleep could recall what they had learned after sleeping,  while people deprived of REM sleep could not. People participating in an intensive language learning course experienced an increase of REM. This indicates that the brain requires more REM sleep in order to assimilate the new information. REM sleep provided endogenous stimulation to prevent the brain from being shut down too long.  REM sleep also acts as an escape valve for letting off the “psychic steam” that accumulates from emotional stresses during the day.  During REM sleep, the body’s inner temperature is no longer well regulated and tends to shift toward the temperature of its surroundings,  just as in reptiles. Astronauts take a Schumann field generator with them to produce 7.83 Hertz ( which is also the frequency of the earth and Hindu king mantra OM ) , to get proper REM sleep.   This Schumann generator can generate full strength Schumann resonance which is in harmony with the 7 chakras of the human body.  Without this resonance, the top 3 chakras in your body are rendered ineffective. HAARP can deprive you of your REM sleep.

Time is a pool out of which we can pull up the past, the present and the future; and time, mind and consciousness are synonymous. If past , present, and future are happening simultaneously within us at all times, this means that by examining our past lives, we should be able to see what our futures hold. But in truth, the future is not fixed. This is because through exercising our free will, or our ability to make choices, we have the capacity to re-create our renegotiate our future. The concepts of past and future exist only with reference to the concept of the present moment, which is the central point in time. What was once present is now past, and what will once be present is now future. Both the past and the future are the present when they occur. But more importantly, the past and the future are both concepts that exist only in the present moment. Therefore, relatively speaking, the present is the only point in time that is real. 

6000 year old Bhagawad Gita is all about being in the moment. It asks us to seize the moment. Though all that passes by it is constantly changing, the present moment itself always remains without undergoing any change, and hence it is the static gateway through which we may pass from the illusion of ever-changing time to the reality of our ever-unchanging being.

If something travels faster than light, it means that it can penetrate any matter as though it wasn’t there.  Therefore scalar waves pervade all matter and cannot be shielded against by Faraday cages . Vedic healing waves ( lifted by Reiki ) waves pass through the earth.

Below: 4000 YEARS AGO ADI SHANKARACHARYA WRITES ABOUT SPACE TIME ( 2.49 OF VIDEO )- THIEF EINSTEIN JUST STOLE THE VEDIC CONCEPTS 



captainji
if i am not mistaken melpathur narayana bhattatirippad has in the opening verses of "narayaneeyam" composed around 400-500 years back has mentioned kala and desa which means time and space. what is this "beyond space and time?"

thanks




  1. hi rs,

    ADI SHANKARACHARYA WROTE 4000 YEARS AGO-

    "time and space, are creations of MAYA (`maya-kalpita-desha-kala-kalanat' -- dakshinamurti-stotra, sloka no.4).

    The very fact that we are conscious of the passage of time is a consequence of maya.

    Ultimate reality is beyond space time. Time, space and causation are like the glass through which the Absolute is seen. The Universe is the Absolute seen through the screen of time, space, and causation (kala, desha, nimitta).

    As in the field of modern physics, so in the field of vedanta, time and space are modes incidental to sense perception and should not be applied to what is trans-empirical.

    The acceptance of the reality of the dream to the dreamer is the king-pin of Shankara's explanation of Advaita.

    This reality, called `vyAvahArika-satyaM' is in between the total unreality - `asat' - of the barren mother, and the total reality - `sat' - of brahman.

    The dream and similarly the perceptible universe is neither `sat' nor `asat'. It is `mithyA'. The meaning of the word `mithyA' is not falsehood but comparative unreality.

    TTime and space come into the divine geometry of Sri Yantra as a pair of opposites, so that if the space separation and the time separation between two events, say here-now and there-then, are equal, the total separation between those two events is zero.

    Werner Heisenberg's uncertainty principle is MAYA.

    Heisenberg pointed out that the product of our necessary uncertainty in where a particle is and our necessary uncertainty in its momentum can never be smaller than Planck's constant over two pi. Also that the product of our necessary uncertainty in when something happens and our necessary uncertainty in the energy of the happening can never be less than that same amount.

    Once science breaches Vedanta, the last frontier falls.

    capt ajit vadakayil
    ..

Quantum physicists went to the heart of matter and were astounded by what they saw. Matter was not solid at all as our senses tell us but merely energy in motion. It is written that time and space are relative. This is the heart of Vedanta. 6000 years ago the Bhagawad Gita declared that what binds us to wheel of samsara are the three mental bonds known  as desa, kaala and nimitta, - space, time and causality and that these are purely mental bonds which we have created ourselves. We have created this world of concrete objects and superimposed a false reality on them. Again and again our scriptures tell us that Absolute reality is beyond these three upadis -desha, kaala and nimitta or space time and causality. This world which we think we see is maya or an appearance. It has no permanent reality. It is only a passing show and has no permanence. Our bodies which are made of the same material - the five elements are also perishable.  BUT we are not solely these bodies. Our reality is something far greater since we are actually the atman - which is imperishable and eternal and untouched by the changes of the body which take place in the world of space /Time. The moment we demarcate ourselves as belonging to a specified place and time, that moment we separate ourselves from our roots and thus bring suffering on ourselves. We are the creators of time and space. When we bring energy to conscious awareness, through the act of perception we create separate objects that exist in space through a measured continuum called time. By creating time and space we create our own false separateness. If we want to understand the universe we will have to see it as a dynamic web of interconnectedness. Human beings are a coalescence of energy in a field of energy which is connected to every other thing in this universe. This energy field is the central engine of our being. We can never be estranged from the other aspects of this universe since we are all bound fundamentally to this field ( brahmAn )!. Our soul is just a part of brahmAn, the mother field  sheared off with lowered frequency and sent to planet earth for gaining experience and evolution. As the soul evolves its frequency increases. When the frequency is increased to match the frequency of the mother field , moksha happens and the soul merges with brahman. YOU are now god. YOU share your experience with god in a closed loop. BrahmAn knows everything . Human suffering stems from this very fact, that we have cut ourselves off from our roots and have condemned ourselves to a life of isolation. This was not how nature meant us to be.  Modern physics  has thus given us a correct evaluation of our place in the world. The human consciousness (as our scriptures have always told us) is a crucial factor in making up this universe. Sub atomic particles settle down from their constant erratic movements and take on solid shapes only when we observe them.  Matter is composed of subatomic particles that have no design or shape and do not follow any standard order. Sometimes they behave like waves and sometimes like particles and sometimes they are both as well as many things at same time. Hence these physicists actually proved the maya theory in a scientific way. The entire white skinned Quantum physicists wrote in their wills that they want to be cremated and not buried. As the Gita tells us in chapter 3, “ Sahayajna praja sristwa purovacha prajapati.” - The creator created all of us and instilled the idea of yajna or selfless action in us. No man is an island and no one can live without any sort of dependence on others and on nature. There is no me and mine as we think but all things are connected in an amazing way to the energy field. “Mamta and ahamta” (me and mine) have always been considered to be the two knots which alienate us from god. In this unified field there is no place for EGO laden me and mine. Any selfish act immediately isolates us from the world and from nature and many such acts eventually bring unhappiness, discontent, ill health and continuous bad luck which we blame on others and on our fate etc. never realizing that it is only a consequence of our own selfish actions. Here is where the law of karma comes into play. Our world is shaped by our own actions. In this respect we must understand that our thoughts are also actions. As Krishna says in the human being, INTENT is even more important than the actual action. Pure energy as it exists on the quantum level is not bound by time or space but exists as a vast continuum of fluctuating change which exists here and now. This moment, this tiny bit of time and space we are existing now is the only truth and reality. The past is a dream and the future a fantasy. What exists is the present which again has only a fleeting reality.  Bhagawad Gita tells us to be in NOW- to seize the moment. This is this planet’s ultimate lesson and can never ever be surpassed.Quantum physicists agreed with Bhagawad Gita ,that individual consciousness does not die with the death of the body . Krishna says, “Like a man changing his clothes so also the spirit changes one body for another. But the spirit lives on so why grieve when someone dies. It is only his body, which was unreal in any case, which has passed on to the elements from which it came into existence. His reality is the atman which was never born and thus can never die. Quantum physicists discovered that the world as we see it and as the maharishis stated is not real. The quantum world deals with shadow symbols, it is a dream world but it is not the ultimate reality as they themselves are willing to admit.  It is a shadow quantum world beyond the veil of MAYA and we see only the shadows of things but not their reality. The shadows appear to be the whole world and this is because of a strange phenomenon in which our minds get bound up in the cocoon of time, space and causality and imagine the shadows to be real. This is the world which the Gita describes in the 7th chapter.. “Bhumi, aponalo vayu, Kham mano, buddhi eva cha. Ahamkaram itiyam me bhinna Prakriti ashtada. “My lower Prakriti is eight-fold and is composed of the five elements, earth, water, fire, air, space, mind, buddhi and ego. But this is my lower Prakriti which is available to the senses and which we believe to be real..  He then goes on to say “Apareyamitastwanyam Prakriti viddhi me param.” “But know this to be my lower nature. My higher nature is that spiritual being which sustains this entire universe and which is totally different from this.” Krishna continues in the 7th chapter, “These two natures form the womb of all beings. I am the origin and dissolution of the entire universe.” Krishna declares, “All things exist in Me but mark my mystery, I do not exist in them” What he means to say is that god in not a sum total of all creation. Even though they are in Him, he is not in them and that is why no amount of enquiry into the shadow world can give us the truth of absolute consciousness. Sanatana Dharma is not for halfwits.  The Newtonian scientist will NOT accept the TV remore works as he cant pick up the invisible waves with his 5 senses. Till now the experimenter's job was always to get out of the way of the experiment and not interfere with the purely mechanical process involved in the experiment. Now it was proved by the scientist that the individual consciousness has everything to do with the final outcome of the experiment. This consciousness stems from a phenomenon known as super-radiance which is a state of perfect coherence. Quantum particles act in a haphazard fashion of chaos or disorder but when the individual consciousness is brought to bear on them, they lose their individuality and begin to act as a single unit. This coherence extends into the world. This coherence of consciousness represents the greatest form of order known to nature and can help to shape and create order in the world. In meditation and especially in the state of samadhi, our brain reaches that zero point field of the chitta which has perfect coherence. This is the substructure which underlies the whole universe. It is a recording medium of everything, by which everything can communicate with everything else.  Consciousness of people has incredible powers. It can increase order in the world and make it as we wish it to be. If a number of individuals concentrate and wish for the same thing it has even greater force. It is not a wise thing to hijack the Sabarimala pilgrimage or the Thrissur pooram.  What do these COLLEGIUM LAWYER TURNED JUDGES know?A large number of individuals meditating at the same time can produce a great amount of coherence in the world outside. . The fractal minds of our rishis opened our eyes to a world of mystery and beauty. Kosher thieves have lifted the essence , patented in their names and wrangled Nobel prizes.





2.45- - samadhisiddhirishvarapranidhanat

Realization is experienced by making the Lord the motive of all actions.

Patanjali's concept of Isvara in Yoga philosophy functions as a "transformative catalyst or guide for aiding the yogin on the path to spiritual emancipation"  When my elder son was leaving India to study computer science at Cornell, Ithaca, US, my wife took him to the Muthappan temple at Calicut.  In a corner of the temple premises was a small room with a lit lamp inside  . The shrine was empty-there was NO deity .  Outside the tiny shrine was written in Malayalam GURU.  My wife told me that this is the shrine of their KULADEVATA ( family gotra deity ).  Obviously is it brahmAn, the field.
In Hinduism the Hindu has the freedom and choice of conceptualizing Isvara in any meaningful manner. No dogma is imposed. During the white invaders rule the FAKE and backdated Bhakti movement of Jew Rothschild created dogma. We had devotees or Shiva and Vishnu fighting like cobra and mongoose. In the practice of Yoga Nidra, we look to reach the hypnagogic state – the state between waking a dreaming in which the ego-mind isn’t as in control as it might usually be. When we’re in the hypnagogic state, we’re able to relax even more than we might do when sleeping. The hypnagogic state of consciousness, during the onset of sleep has been lifted from Vedanta and termed as the Alpha state  by modern scientists. Since life began, the Earth has been surrounding and protecting all living things with a natural frequency pulsation of 7.83 HZ—the ancient Indian Rishis called OM. The fundamental mode of Schumann's resonance is a standing wave in the ionospheric cavity with a wavelength of the circumference of the earth. In deep meditation, when waves of alpha and theta rhythms cascade across the entire brain, a resonance is possible between the human being and the planet. Energy and information which are embedded in the zero point field or aether field are transferred. The planet communicates with us in this primal language of frequencies. Alpha brain Frequency of 7.83 HZ on the EEG,  is also known popularly as Schumann’s  ( Vedic ) Resonance . 7.83 HZ or the ALPHA frequency  is the gateway that leads into deeper states of consciousness.  Most people are in an alpha state during the short time immediately before they fall asleep and when the conscious nervous system switches over to the subconscious. 7 to 12 HZ range is frequency range for relaxed consciousness  , psychic Stimulation , mind body integration , inner awareness , visualization and  whole brain thinking. The alpha wave state is a sign of deep relaxation while awake. You experience a liberating sense of peace and well-being. The "alpha state" is where meditation starts and you begin to access the wealth of creativity that lies just below our conscious awareness.  Alpha is also the home of the window frequency known as the Schumann Resonance, which is the resonant frequency of the earth's electromagnetic field. When we intentionally generate alpha waves and go into resonance with that earthy frequency, we naturally feel better, refreshed, in tune, in synch. It is, in fact, environmental synchronization. The frequency of the living Earth, the “Schumann Resonance” of 7.83 HZ is the lowest common denominator of psychic activity repeatedly observed by EEG and EKG observations. Schumann Resonance  waves propagate with little attenuation around the planet..  For thousands of years the Schumann Resonance or pulse (heartbeat) of Earth has been 7.83 cycles per second, recently due to military ELF waves from HAARP , GWEN and Woodpecker,  this resonance has been slowly rising. Modern spacecrafts are said to contain a device which simulates the Schumann waves. by producing a 7.83 Hz pulse ( frequency of OM ) with a field generator (Schumann device), we can counter the effects of the irritating man-made fields. By replicating the Earth's natural rhythm, we may be providing ourselves (at least in our immediate vicinity) with a more healthy environment. Theta brain waves are associated with " subconscious mind " --while delta is connected with " unconscious mind " Beginners of meditation can go only to alpha and theta. The ancient Vedic rishis (lesser ones ) took Soma , a potent drug stronger than LSD to go into the delta range for terrific intuition . They could tap into " universal knowledge " ( the mind beyond our own or the collective unconscious. Mind is an outgrowth of the basic laws of quantum physics together with the actions of the observer, which are the acts of consciousness. Feelings and thoughts show the same type of duality as waves and particles. Consciousness is created by quantum mechanical phenomenon that takes place in brain cells. This is why a supercomputer cannot recognize a joke or tell the moral of a story like “ Unity is strength” . We have unlimited access to the radiant field of consciousness which is infinite active universal intelligence. We all have direct and immediate access to the scalar field of consciousness . There is a connection between DNA and consciousness .The brain and the DNA are transducers for quantum information from the scalar field. Quantum coherence in the micro tubules of every cell is the key to consciousness . This explains the mysterious powers of Reiki. The greatest discovery of our Earth is its consciousness. A visible attribute of consciousness is an energetic field that governs the shaping of organisms. Morphogenesis is a scientific term to explain this very shaping of tissues, organs, and entire organisms. Consciousness is the creative force of the entire universe. The entire universe is in fact a single living conscious organism with complete awareness of itself. This is the power of brahmAn, the field.  99.99% people never raise their consciousness much above that of the animal and the spark of divinity within them remains dormant the whole of their lives. We see incredible order and harmony and pattern which no accident can produce. The material universe is the result of an image projected by the creative power. Each mineral is crystallised according to a definite design or image. The image of the human being is contained within the microscopic DNA strands of the fertilised egg in the womb. Some kind of intelligent force ( consciousness ) must have started with an image or blueprint which ultimately manifested itself as a particular form. Consciousness is a form of electromagnetic energy which with focused thought and intent can achieve extraordinary things. After the conversations about Indian philosophy, some of the ideas of Quantum Physics that had seemed so crazy suddenly made much more sense." - W. Heisenberg (German Physicist, 1901-1976). Surrendering our ego and our selfish desires is very closely linked to the concept of ‘letting go of the fruits of our actions’ and ‘non-attachment’, which is a focal point of the Bhagavad Gita. In our daily life off the yoga mat, Isvara Pranishana can be seen as less of a devotional dedication or a surrendering, and more of an ‘opening up to what is’, and instead of fighting against life’s twists and turns, remaining open to experiencing life as it unfolds.  Remaining fixed and rigid in our conditioned patterns, habits and limitations only leads to a limited life. Surrendering is hugely challenging, because it means transcending the ego, and the ego will do everything it can to hold on to some control. Without the conditioning, worries, perceptions and judgements that we falsely hold so closely to us, the ego would not exist, and therefore it tries desperately to cling on when we work on quietening it. Surrendering to what is requires trust in our deepest Self, our intuition and the courage to express ourselves for who we are, as we are, with all of our perfect imperfections, which ultimately leads to freedom. This state of being is also known as ‘creative surrender’, as it is a deliberate and conscious relaxation of the mind and body. When we reach this state, we surrender and open up to reality, creating space in the mind for reality to flow through. The hypnagogic state sheds light on how our thought processes can be very different when we’re truly relaxed than when we’re in our usual mindset. It is said that the hypnagogic state is one in which there is a ‘loosening of ego boundaries’ and creative ideas are more fluid. Yoga is about creative surrender and entering a state of deep relaxation. In the borderlands between wakefulness and rest is a strange and fascinating state of consciousness characterized by dream-like visions and strange sensory occurrences. Psychologists call this stage "hypnagogia," but centuries before they created a term for it, artists were using the hypnagogic state to tap into some of their best ideas. During this state, the mind is "fluid and hyperassociative," giving rise to visions that can "express layers of memories and sensations". Similar to REM sleep -- the state of deep sleep when our dreams occur -- the mind is cycling through thoughts, ideas, memories and emotions, making free and often distant associations between diverse concepts. But unlike REM, during hypnagogia you're conscious enough to be at least partially aware of what's going on. Scientists have observed the presence of both alpha brain waves -- which are the dominant brain wave mode when we are conscious but relaxed, for instance when daydreaming or meditating -- and theta brain waves, which are associated with restorative sleep, during hypnagogia. Typically, these brain waves occur only separately, and it may be the unique combination that gives rise to unusual visions and sensations. The state is also marked by reduced activity in the prefrontal cortex of the brain, which is involved in planning, decision-making and social behavior. In some ways, hypnagogia is the best of both worlds. You get the free flow of ideas and associations that occurs during REM sleep -- when the brain reviews and processes memories, thoughts and feelings -- but you're still awake enough to be somewhat conscious of what's going on. For this reason, creative people have entered the ZONE OF THE MAHARISHIS and found hypnagogia to be a rich source of ideas and inspiration. By surrendering the results of our actions, as told by Krishna 6000 years go, or simply learning to trust in the universe a little more; each time we do choose to surrender, we move closer to freedom. Nikola Tesla has told about his creative visions while in the zone of the Indian rishis. Ishvara  is the Absolute Brahman, the Unchanging Reality.  Praṇidhana is used to mean a range of senses including, "laying on, fixing, applying, attention (paid to), meditation, desire, prayer.”  The word Ishvarapraṇidhana means committing what one does to the supreme purusha who is the first GURU (paramaguru) and is free of all hindrances and karma.  It literally means  acceptance.   Patanjali's concept of Isvara in Yoga philosophy functions as a "transformative catalyst or guide for aiding the yogin on the path to spiritual emancipation"



Recently or ex-CJI Markandey Katju was making extremely sarcastic of Srinivasan Ramanujan for asking his Kuladevata permission to travel abroad .  By the way Katjus are Kashmiri Brahmins , who opportunistically converted to Islam during foreign muslim rule ( for cushy jobs )  and then converted back to Hindusim when the power passed on to the white invader. Almost all of the Katjus eat beef and most of them are still muslims. It took Srinivasan Ramanujan three days to connect with the field while sitting in deep meditation within the shrine of Goddess Namagiri.  Suddenly Ramanujan woke up from the theta state and told his well wisher that the Goddess has permitted him to go to England . Peabrained Katju will never understand the secrets of the human mind.




Early morning before daybreak Hindu women draw Kolams outside their home doors as a Isvara-pranidhana.   These morning offerings, like so many everyday rituals in India, embody the yoga practice of Ishvara pranidhana—surrendering (pranidhana) to a higher source (Ishvara). Ishvara pranidhana is a “big picture” yoga practice:  It initiates a sacred shift of perspective that helps us to remember, align with, and receive the grace of being alive. To shallow minded west idea of surrender as a virtue may seem savage.



Many of us have only experienced surrendering to a higher source as a last resort, when we’ve confronted seemingly insurmountable problems or in some other way hit the edge of our individual will and abilities. But in the Yoga Sutra, Patanjali transforms “surrender” from this sort of last-resort, emergency response into an essential ongoing practice. Patanjali repeatedly highlights Ishvara pranidhana as one of the five niyamas, or inner practices, of the ashta-anga (eight-limbed) path.In Indian yoga, intuition is the single greatest tool to finding happiness .  Intuition is soul guidance or the inner voice. Intuition helps you stay in the present, like what is advocated in the Bhagavat Gita.  It has little to do with predicting the future. . Playfulness and relaxation usually stimulate the intuitive process. All the human senses are channels for intuition and every cell can be an antenna to receive information.  Intuition is a gift of crisis--- It tells you the right thing to do when you don't have time to figure it all out.  Intuits are able to see possibilities and alternatives that aren’t immediately apparent. Your inner knowing comes from first your instincts, second your intellect, and third from your intuition. Intuition is not pseudo-science . It is an essential psychological function like thinking, feeling and sensing. The divining power of intuition comes from our inner self. It arises from very rapid processing of bits of information that are stored in our subconscious. Intuition thinks in terms of metaphor, feelings, pictures, and the spatial whole and doesn't fit neatly into the cause-and-effect model. It is about trusting your own integrity - trusting your gut, trusting your heart.. . Your intuition will not force you to do things that are truly wrong for yourself or other people in contradiction with the laws of the universe. Intuition is listening to the inner voice or heeding the promptings from within.  Intuition is a ability to cut through the thickness of surface reality . Intuition and confidence go hand in hand. Your sub-conscious which operates a dozen times faster than your conscious mind has picked up on signals that your conscious mind has not yet processed. We function through partial information, and intuition gives us an overview, a whole sense of things. Intuition acts like a bridge between your logical reasoning and the sum total of your experience-based knowledge. Intuition is a knowing, a sensing that is beyond the conscious understanding — a gut feeling-- flashes of spontaneous thought that are done apparently without relating to facts or logic. Intuition is fast, based on pattern matching. The divining power of intuition comes from our inner self-- very rapid processing of bits of information that are stored in our subconscious. We cannot command our gut feeling to use it at will. It just surfaces spontaneously when certain circumstances are present. Intuitive insights suddenly appear as ideas or feelings.Intuition is now an EQ competency. It’s considered something necessary to successful living, and something to be respected and valued. Intuitive decisions are NOT guesswork . Intuition has an important role to play in decision making . Intuition is not limited to opinions but can encompass the ability to know valid solutions to problems.  Intuition usually shows up in the areas where you have passion and talent. By logic that we prove, by intuition we discover. Intuition is a sudden and inexplicable knowing. It lies at the roots of spontaneity, humor, creativity, inspiration, and even genius. Intuition has its own unique language for communicating with you through touch, sight, taste, sound, and smell. As you pay attention to your senses, you’ll begin to understand the “vocabulary” of your intuition.  Mental static and ego can get in the way of tapping into intuition. Intuition bubbles up from within and can be overwhelmed by old mental or emotional "tapes" . Intuition gone wild becomes “jumping to conclusions”. By going too far out on a limb , you risk misinterpreting the situation and start harming others. Intuition should not be overused. Your brain is a complex tapestry of interacting neurons, all working together to provide you with insights that guide you through life. It’s complicated. So complicated that your conscious brain cannot keep up with everything it’s trying to tell you. So what exactly is intuition? It is the messages from your unconscious mind making contact with your consciousness. . The uncanny ability to detect patterns in the world around us, and to extrapolate larger truths . Use it always, never ignore it. Our instincts and intuition are more reliable in a decision making, than our conscious brain. . By listening to what our heart and soul tells us to do - and then doing it - we can take ourselves anywhere we have ever dreamed of going. Your consciousness only uses a tiny proportion of your brainpower and your intuition accesses the residual power and communicates to your consciousness the bank of wisdom and knowledge it has available. This is done subtly through thoughts, feelings, sensations, images, sounds or any combination of them. Just as animals have a natural survival instinct so humans are born with the natural ability to be intuitive; your human instinct. Traits often found in those with high intuitive intelligence include-- an awareness of one's personal value system, a healthy awareness of one's own feelings, an ability for self-direction and self-management, a powerful level of self-trust, a desire for innovation, a refined knowledge of one's strengths and weaknesses, and a high degree of self-regard and freedom. Never ignore the inner spark , the gut feeling, the sixth sense or hunch that ignites vision and leads you to success. Intuitive insights motivate us to grow closer to the creative source, thereby igniting our own creative spark and expression, which is the essence of our true self. When you feel excited about something, that's a hint about what to pursue. Isvara Pranishana is less of a devotional dedication or a surrendering, and more of an ‘opening up to what is’, and instead of fighting against life’s twists and turns, remaining open to experiencing life as it unfolds.  Remaining fixed and rigid in our conditioned patterns, habits and limitations only leads to a limited life. Surrendering is hugely challenging, because it means transcending the ego, and the ego will do everything it can to hold on to some control. Without the conditioning, worries, perceptions and judgements that we falsely hold so closely to us, the ego would not exist, and therefore it tries desperately to cling on when we work on quietening it.  Surrendering to what is requires trust in our deepest Self, our intuition and the courage to express ourselves for who we are, as we are, with all of our perfect imperfections, which ultimately leads to freedom. Patanjali advises us to ‘surrender’ to this Supreme Being or higher self, which in essence means cultivating a deep and trusting relationship with the universe and to follow the laws of the universe. This is indeed the meaning of spirituality .The yogi is aware that something bigger, more profound and pure exists other than himself.. The ‘easiest’ path to peace and realisation, requiring no effort or pain on our part – we simply let go, devote everything to a higher power and completely devote our actions to whatever we consider that higher power to be….Surrendering our ego and our selfish desires is very closely linked to the concept of ‘letting go of the fruits of our actions’ and ‘non-attachment’, which is a focal point of the Bhagavad Gita.The practice of surrendering here requires us to acknowledge that we can do our very best in each situation, but we can’t really do any more than that; realising this essentially allows us to fully engage and be present in what we’re doing, bringing all our energy to that moment , the NOW, and experiencing it fully just for what it is – what happens after, happens after. Worry does not empty tomorrow of its sorrow, it empties today of its strength. This is the message of Krishna in Bhagawad Gita. It is way different from single holy book religions which command you to kill all those who does not worship your god.

Below: A young Brahmachari Dayanand Saraswati whom APCO Modi is praising to the skies was first part of Brahmo Samaj and the chela of Dwaraknath Tagore , the Opium drug runner of Jew Rothschild..   Arya Samaj of Dayanand rejected Hindu gods like Shiva, Vishnu, Rama ,Krishna etc and was initially a part of Rothschild’s theosophical society.



Ishvara-Pranidhana is listed as the fifth niyama by Pantanjali.  In Hinduism, the Niyamas are the "do list" and the Yamas are the "don't do" list, both part of an ethical theory for life. This Niyama of Patanjali adds the characteristics of Isvara as that special Self which is unaffected ( aparamrsta) by one's obstacles/hardships ( klesha), one's circumstances created by past or one's current actions ( karma), one's life fruits , vipâka), and one's psychological dispositions/intentions (ashaya).
Isvara Pranidhana is about cultivating a deep and trusting relationship with the universe, and making each action an offering to something bigger than us.   The Ishwara of God in yoga is NOT a deity— it is a field ( brahmAn ) of which the soul is a detached part with reduced frequency. This soul must evolve by the laws of Karma, raise its frequency and merge back to the mother field of brahmAn to provide the feedback loop. .This is real evolution , not the monkey to man concept of madman Charles Darwin. In Yoga sutras Ishwara is a logical construct. This is a means to begin the process of dissociating from external world, connecting with one's inner world, focusing and getting one-minded in Yoga. Isvara is not an ontological concept, rather it has been an abstract concept to meet the pedagogical needs for human beings accepting Yoga philosophy as a way of life. The main components of an ontology are concepts, relations, instances and axioms. Jew Rothschild created Arya Samaj and Brahmo Samaj – lifted from Christian and Islamic movements in India – to conceptualize Ishvara as a monotheistic all powerful Lord.  Sorry, this is NOT Sanatana Dharma. It wont work . Sanatana Dharma leaves the individual with freedom and choice of conceptualizing Isvara in any meaningful manner . The need and purpose of Isvara, whatever be the abstraction of it as "special kind of Self" or "personal deity", is not an end in itself, rather it is a means to "perfect the practice of concentration" in one's journey through the eight limbs of Yoga philosophy.   In the Samkhya school of Sanatana Dharma, Purusa is a central metaphysical concept, and envisioned as "pure consciousness". Further, Purusa is described by Samkhya school to exist in a "plurality of pure consciousness" in its epistemological theory (rather than to meet the needs of its ontological theory). In Yogasutras, Patanjali defines Isvara as one among the plurality of "pure consciousness".Isvara Pranidhana can be thought of as ‘offering up the results of one’s actions to the divine’, or as per the laws of the universe to humanity. Isvara Pranidhana in your work and ‘dharma’ or ‘life duty’. When we reach the hypnagogic state, we surrender and open up to reality, creating space in the mind for reality to flow through. The hypnagogic state sheds light on how our thought processes can be very different when we’re truly relaxed than when we’re in our usual mindset.  There is a  a ‘loosening of ego boundaries’ and creative ideas are more fluid. Patanjali does not ask the yogi to surrender to a deity on a pedestal , you are asked to surrender to the Ultimate Reality. Yoga makes us feel good; it heals us when we’re hurt, and it helps us find light when all we see is dark, but it also shows us what we’re made of when things get tough. Isvara Pranidhana is an easy path to peace and realisation, requiring no effort or pain on our part – we simply let go, our proactive actions to whatever we consider that higher power to be….The state of ‘creative surrender’,  is a deliberate and conscious relaxation of the mind and body. When we’re in the Hypnagogic state, we’re able to relax even more than we might do when sleeping.  Whether it’s surrendering to a moment of difficulty or a moment of joy, surrendering the results of our actions, or simply learning to trust in the universe a little more; each time we do choose to surrender, we move closer to freedom.  For Patanjali, Ishvara pranidhana is a potent method for dissolving the endless agitations of the mind, and thus a means to the ultimate unified state of yoga: samadhi.  Because Ishvara pranidhana shifts our perspective from the obsession with “I”—with our narrow individual concerns and perspective—that causes so much of the mind’s distraction and creates a sense of separation from our Source.   Since Ishvara pranidhana focuses not on ego but on the sacred ground of being, it reunites us with our true Self. Ishvara pranidhana provides a pathway through the obstacles of our ego toward our divine nature—grace, peace, unconditional love, clarity, and freedom.Ishvara is the inner compass, pranidhana is remembering to stay connected to that essence not just occasionally but throughout the day. A yogi always stands on high moral ground and uses his conscience. Using his personal charm to wheel and deal like the modern hustlers is never in his agenda. He has core values like fairness, integrity, transparency, respect , tolerance for culture, responsibility , spirit of inclusion etc.  A yogi can respect and appreciate culture in terms of itself. He is sensitive to cultural nuances. . There is no inner state, emotion, or obstacle that is beyond the positive influence of Ishvara pranidhana.  The West must know that Surya namaskar is a method of Ishvara pranidhana.  We live in, Kali Yuga in which all humanity has fallen away from grace. 

Our benami media is hour after hour extolling the virtues of putting your prick into another man’s asshole . 


You are brainwashed to admire the graceless and UGLY and shun the divine and beautiful.



Ishvarapranidhana is more than just bowing to a deity in a altar. It is an attitude and a way of being which allows one to identify with the eternal aspects of one’s own self rather than identifying with the everchanging mind and body.  Ishvara is known as divine awareness, absolute consciousness, the eternal witness that lies within each of us. Pranidhna indicates aligning with, applying one’s self to, surrender, devotion and dedication. Ishvarapranidhana can be regarded as orientating and aligning ourselves with our own internal eternal divinity. An example of this is the surrendering of our mind and ego in order to witness our true self. Patanjali states that it is this surrendering of the active mind with dedication and devotion that allows one to attain and perfect Samadhi; union with the divine. Advanced practitioners of yoga and meditation will agree that surrendering the activities of the mind is crucial in attaining deep states of meditation and beyond. Yoga is not a mere physical exercise. This type of surrender does not mean losing a battle or giving up , or throwing down the towel in a negative sense. This is a surrender from the heart. It encompasses trust, devotion, and love for our Divine Source. It shifts our perspective and awakens us to our deep connection to God or ‘higher power’.To surrender is to let go of our expectations, habits, judgments, prejudices and criticisms. Surrendering is about allowing life unfold with gratitude. As we let go of our limiting perceptions, life flows with freshness and freedom. Ishvara pranidhana is not about what your yoga can do for you, but about approaching your practice in the spirit of offering.Surrender is the simple but profound wisdom of yielding to rather than opposing the flow of life.We let our heart determine our choices instead of our minds. When we surrender we see through the eyes of love. We start to accept life in its crazy, beautiful entirety, and in doing so we free ourselves up to do what makes our heart sing. We begin to let the divine spark inside us express itself. Life becomes an adventure. We allow happiness to alight on us like a butterfly rather than chasing it. We give our body, mind and spirit to the path of love by surrendering every act to love and sharing.  .   In Isvara Pranidhana, we devote our practices to a higher power without expectation. With devoted practice, we cultivate awareness, intuition and oneness with the universal energy that flows through us.   With devoted practice, we build our personal connection to this life force such that the act of surrendering is not complacency, but trust.  Surrendering and devoting our actions to this higher power. Ishvara pranidhana helps you to remember that the universe does not revolve around you, that you don’t need to have all the answers. Ishvara pranidhana is the surrender, consecration of our actions and the will to something greater than ourselves. You trust in the Divine, the abandonment peace, non-attachment (moha) or craving of pleasure (lobha) that generates pain (soka), confident that the problems are transient phenomena and that everything passes, and that time heals .


THIS POST IS NOW CONTINUED TO PART 58, BELOW-








CAPT AJIT VADAKAYIL
..




66 comments:

  1. captainji
    if i am not mistaken melpathur narayana bhattatirippad has in the opening verses of "narayaneeyam" composed around 400-500 years back has mentioned kala and desa which means time and space. what is this "beyond space and time?"

    thanks

    ReplyDelete
    Replies
    1. hi rs,

      ADI SHANKARACHARYA WROTE 4000 YEARS AGO-

      "time and space, are creations of MAYA (`maya-kalpita-desha-kala-kalanat' -- dakshinamurti-stotra, sloka no.4).

      The very fact that we are conscious of the passage of time is a consequence of maya.

      Ultimate reality is beyond space time. Time, space and causation are like the glass through which the Absolute is seen. The Universe is the Absolute seen through the screen of time, space, and causation (kala, desha, nimitta).

      As in the field of modern physics, so in the field of vedanta, time and space are modes incidental to sense perception and should not be applied to what is trans-empirical.

      The acceptance of the reality of the dream to the dreamer is the king-pin of Shankara's explanation of Advaita.

      This reality, called `vyAvahArika-satyaM' is in between the total unreality - `asat' - of the barren mother, and the total reality - `sat' - of brahman.

      The dream and similarly the perceptible universe is neither `sat' nor `asat'. It is `mithyA'. The meaning of the word `mithyA' is not falsehood but comparative unreality.

      TTime and space come into the divine geometry of Sri Yantra as a pair of opposites, so that if the space separation and the time separation between two events, say here-now and there-then, are equal, the total separation between those two events is zero.

      Werner Heisenberg's uncertainty principle is MAYA.

      Heisenberg pointed out that the product of our necessary uncertainty in where a particle is and our necessary uncertainty in its momentum can never be smaller than Planck's constant over two pi. Also that the product of our necessary uncertainty in when something happens and our necessary uncertainty in the energy of the happening can never be less than that same amount.

      Once science breaches Vedanta, the last frontier falls.

      capt ajit vadakayil
      ..

      Delete
  2. Sir, what do you have to say about Jainism?

    ReplyDelete
    Replies
    1. http://ajitvadakayil.blogspot.in/2013/06/kalidasa-did-not-exist-jainism-is.html

      Delete
    2. What do you have to say about markandeya purana and markendaya !

      Delete
  3. Sir what is the story behind the vegeterian crocodile of ananthapura lake in kerela?

    ReplyDelete
  4. http://hindi.insistpost.com/22229/10-secrets-of-mahabharat-war/2/ जानिए महाभारत युद्ध के टॉप 10 गुप्त रहस्य जो कोई नही जानता.Sir plz look into it very interesting.And give us your perspective.

    ReplyDelete
  5. https://www.youtube.com/watch?v=8vkF64ezRaQ
    Vatican was taken over in the year 300 as the khazars conquered Egypt and Rome
    Islam was created by them to overtake the Persians
    China was infiltrated by Matilda the Hun s grandson from the north east
    Russia was always their stomping grounds
    Saudi Arabia is a Vatican offspring a contribution for the infiltration of Persia and whom are Vatican offspring too
    Switzerland is the center of the khazars evil empire as they conquered Europe back in 3rd century
    Propaganda lies deception brainwash con men teaching their offspring to do the same
    Evil. Pure. Evil.

    ReplyDelete
  6. Namaste Sir,
    what a co-incidence i just wanted to ask the same question which u have just begun to explain i.e. WHAT IS TIME ?
    Sir
    Does time flow at different Speeds in different Yugas ?? was time slower and people lived to 100's of years in satya yuga ?

    Sir ,
    Are GIANTS Living in afghanistan & Big-Foot one and the same ancient Hindu clan of immense power ??

    Sir ,
    Did US Soldiers really find an ancient flying Vimana locked in a time-well in Afghanistan ??

    ReplyDelete
  7. http://timesofindia.indiatimes.com/world/Lord-forgive-us-for-so-much-cruelty-Pope-Francis-at-Auschwitz/articleshow/53451833.cms

    THE SECRETS OF AUSCHWITZ INCLUDES THE FACT THAT HITLER WAS A JEW AND SO WERE ALL TOP NAZIS . .

    GAY BARS WERE FIRST CREATED BY JEW HITLER AS A TRAP . . .

    ZIONIST JEWS DID NOT WANT EFFIMINATE CHIKKOO GAYS IN THE PROMISED LAND OF ISRAEL . . .
    Jew Hitler packed his brown shirts/ ss / young nazi group with H U M P I N G A N U S gays . .

    EVEN TODAY COMING OUT OF THE CLOSET , IS ONLY TO PROFILE THE GAYS .. . . EVERY GAY CLUB HAS HIDDEN CAMERAS .. .

    Hey gays, welcome to the REAL world . .. .

    ALMOST EVERY HOMOSEXUAL IS A PED0PHILE . . . THEY ARE NOT THE SALT- NAY- BOUNTY OF THIS PLANET . . .

    http://ajitvadakayil.blogspot.in/2015/10/if-zionist-jews-created-isis-who.html

    ReplyDelete
  8. Raju Sundar
    July 29, 2016 at 7:07 PM

    http://indiatoday.intoday.in/story/sachin-tendulkar-vinod-kambli-friendship-shardashram-team-sach-ka-saamna/1/325965.html
    this is another old piece of news.
    it is not that sachin is not aware that he is being unfair to kambli. but kambli had been cautious enough not to speak a word about the dealings that u had mentioned. defenitly one can smell a rat.

    thanks caps

    ReplyDelete
    Replies
    ###################

    Capt. Ajit Vadakayil

    July 29, 2016 at 11:49 PM
    sachin tendulkar has the gall to substitute his face with goddess laxmi on akshaya tritiya coins .

    some one told him that he is god too . .

    JUST SEE HIS MUG IN THE POST BELOW,

    http://ajitvadakayil.blogspot.in/2013/05/kalasha-symbol-of-cosmic-womb-capt-ajit.html

    WE DONT WANT HIS WHITE SKINNED MOTHER IN LAW TO SAVE INDIA.

    ReplyDelete
  9. http://photogallery.indiatimes.com/celebs/celeb-themes/celebs-favourite-holiday-spots/articleshow/53443617.cms

    EGO FILLED BOLLYWOOD RIFF RAFF

    PRESSTITUTES MAKE MONEY BY PAID NEWS

    ReplyDelete
  10. Namaste captain,
    Organization like sambhaji bigred misguiding the youth of Maharashtra by using the name of chatrapati shivaji maharaj. Sir they denigrate Hinduism daily . They give hate speech against Brahman community. And also they are the supporter of kanhaiyya Kumar. Sir it means that they are supporter of CPM . Sir from whom such organization gets fund . And please expose them

    ReplyDelete
    Replies
    1. please read the post

      http://ajitvadakayil.blogspot.in/2011/02/murky-truths-of-sepoys-mutiny-1857.html

      and specially Captain's reply to
      Silversurferseer

      now you know who they are and how they are misguiding the uninformed people , spread the message like wildfire across the social network

      Delete
  11. Five lakh Hindu-OBC people to embrace Buddhism by 2016. via @dna http://dnai.in/cw9k

    ReplyDelete
  12. Hi Captain,
    Please can you explain more about space time and if really the king kakudmi flew then how that happened. Does ancient vimana had ability to space time travel? The information is so super that I'm lost. I feel like where to start to understand the basics of what you wrote here in space time travel

    ReplyDelete
  13. Sir
    There is a video going around on whatsapp asking 8 questions first is how did England with1 in 3600 ratio to Indian rule us and so on and says if Indians don't look after themselves someone else will. V chilling...

    ReplyDelete
  14. Is it right that 30 min chanting om mantra equal to 8 hours of REM sleep.

    ReplyDelete
    Replies
    1. CHILDREN WHOSE BRAINS ARE FOGGY AND SCORE POOR MARKS IN SCHOOL CAN GAIN REM SLEEP BY SURYANAMASKAR -WITH ASSOCIATED MANTRAS

      http://ajitvadakayil.blogspot.in/2011/10/surya-namaskar-11000-year-old-vedic-sun.html

      Delete
    2. THE POST ABOVE IS THE MOST WIDELY READ -- 96% FOREIGNERS

      SECOND IN RANK IS KARVA CHAUTH--WHICH GOT CHUTNEY MARYs TWATS ABUZZ

      http://ajitvadakayil.blogspot.in/2013/10/karva-chauth-synchronising-fertility.html

      Delete
  15. Captainji, I just realized that since the 9th avatar Lord Ayyappa was the source for freemasonry/egypt occult etc., that is why R replaced him with Buddha as the 9th avatar. The occultist took the left hand knowledge for wrong purposes e.g. freemasonry. But what is interesting is that then this Avatar has set up the environment of today's Kali yuga evils, which the 10th Avatar Kalki will extinguish. Is this the correct train of thought?

    ReplyDelete
    Replies
    1. THE NINTH AVATAR OF VISHNY LORD AYYAPPA WAS HIJACKED BY JEW ROTHSCHILD FOR ZIONIST JEWS. HE NEATLY INSERTED BUDDHA INSTEAD

      BUT TODAY PEOPLE OF INDIA HAVE WOKEN UP.

      SABARIMALA IS THIS PLANETs NO 1 PILGRIMAGE-- KUMBH MELA HAS ONLY 50% CROWD IN NUMBERS

      THEY TRIED TO KILL PAMPA RIVER WITH A PRIVATE CHRISTIAN AIRPORT. even desh ka dammad vadra was involved . today this project is DEAD.

      http://ajitvadakayil.blogspot.in/2013/11/aranmula-airport-kerala-mindless-rape.html

      IMHOTEP IS AYYAPPA

      http://ajitvadakayil.blogspot.in/2011/08/imhotep-patron-saint-of-freemasons-capt.html

      the best part is aristrocrat families in egypt know that imhotep was from kerala. imhotep was respected more than the pharoah- the guest who came from the east.

      Delete
    2. Captain u had mentioned every Vishnu avatar had a purpose and had something to do with kerala.what was the purpose of the 9th avatar?Bhishma defeated Parshuram a Vishnu avatar.Does every avatar vary on strands pf DNA?

      Delete
    3. FOR ONE AYYAPPA LEFT A LEGACY OF THIS PLANETs NO 1 PILGRIMAGE , THE SABARIMALA

      THIS PILGRIMAGE RE-INTRODUCED COSMIC CONSCIOUSNESS

      http://ajitvadakayil.blogspot.in/2013/01/sabarimala-makaravilakku-three-light.html

      AYYAPPA ESTABLISHED THE GOLDEN MEAN OF 1.618

      http://ajitvadakayil.blogspot.in/2011/08/imhotep-patron-saint-of-freemasons-capt.html

      Delete
  16. http://www.thehindubusinessline.com/news/variety/muthoot-pappachan-group-joins-kabali-mania-issues-silver-coins-with-rajinikanth-image/article8849696.ece
    captain
    pleaz expose this fellow also. i know that you like him. but imagine all theaters in TN and even in Kerala & karnataka was booked for this film, that a viewer has no choice other than watching kabali that day. may be rothschild is aware of political vaccum that may come in TN and want this person to replace jj.
    please dont immortalize this fellow.

    thanks

    ReplyDelete
    Replies
    1. there is a big difference

      sachin tendulkar replaced goddess laxmi --goddess of prosperity , on akshaya tritiya coins , as the god of cricket

      how dare he !

      Delete
  17. dear capt.

    you were telling about rahul eashwar the other day. the day he appeared in big brother show 'malayali house' i though his pair will be none other than on an onnllyy runnjini haryydas- god mother of malayali chutney marys. but i think she wud have found it disgusting to pair with pot-bellied malayali mannunny,crack-pots and drunkards. why i mention her?
    she founded a new language by fusing malayalam (56 alphabetz) with english (26 alphabetZ) with no nouns,pronouns,verbs,grammer and defied all rules. and the new language is called MANGLISH. you should have seen how this new language polluted kerala college campuses with girls making awkward pronunciation of words. girls who dont use this new language will be treated as out-castes (new caste system based on language) and side-lined from groups. this language is mandatory for getting in to jobs like vedio/radio jockeys and for anchors.
    there were days when every mother would like her darling daughter to be like this woman and appreciated her boldness. but later when she exceeded the limits of boldness same mothers used to taunt their daughters-'dont be like her'.
    why i mentioned all these things?
    this lady claims that she did some xyz cowrse in some xyz cowlegde in lunden. i wonder what these effing colleges teach their students??

    ReplyDelete
  18. Sir please write about practices and customs for boosting performance in war for Kshatriyas. Write whatever you know.
    Thank you.

    ReplyDelete
  19. Can you please speak on

    Two phobias: Hedonophobia, fear of pleasure and Cherophobia, aversion to happiness, describe this psychological condition.

    I think i have it, one example would be i don't seem to want to enjoy my food ...... hence i rush through it. Would be grateful

    ReplyDelete
  20. Fear of Feeling Pleasure

    http://www.fearofstuff.com/humans/fear-of-feeling-pleasure-2/

    Fear Of Sex – Genphobia

    http://www.fearofstuff.com/humans/fear-of-sex/

    Fear Of Being Touched – Chiraptophobia

    http://www.fearofstuff.com/objects/fear-of-being-touched/

    ReplyDelete
  21. Pranaam Captain

    in MOTHER OF ALL CIVILIZATIONS, SARASWATI 9000 BC -- CAPT AJIT VADAKAYIL post you mentioned about 'flower children' who took on big brother , please explain who are these flower children and how they took on big brother .

    ReplyDelete
    Replies
    1. Hi M,

      This is a a synonym for hippie during 1967 ans Flower Child in San Francisco gathering

      Sushanta Das

      Delete
    2. thanks SKD
      & yes Captain we do really owe to the free thinking hippies of 60's, what an era it was ,just came to know about them

      interesting read

      http://www.huffingtonpost.in/entry/lets-all-thank-hippies-fo_b_55823

      http://members.aye.net/~hippie/hippie/special_.htm

      Delete
    3. IT WAS THE EFFECT OF SANATANA DHARMA ON THE HIPPIES

      http://ajitvadakayil.blogspot.in/2011/10/steve-jobs-answer-is-blowing-in-wind.html

      Delete
    4. Wow what an ass hole Steve jobs was , yes hippies were crazy about India and Neem karoli baba , many of the followers of Neem karoli baba excelled in their respective fields This is the power of Sanathana Dharma , i love krishna das's music

      Delete
  22. Namastey captain
    I want to know the time of economy burst of america.
    When will fail their economy?
    2019???

    ReplyDelete
  23. Aye Captian,

    PLS WATCH THE VIDEO BELOW LIN,K IF THE GIRL WOULD HAVE SAID OMMM WE COULD HAVE SEEN THE FORMATION OF SHREE YANTRA, I FEEL SHE WOULD HAVE SAID BUT GORAS WOULDNT HAVE ACCEPTED IT to SHOW IT TO THE WORLD.
    I BELIEVE YOUR HONESTY
    YOU ARE RIGHT AND U WILL BE ALWAYZ RIGHT, WORLD IS AWAKENING, WORLD OWES YOU AND VEDANTA SO MUCH, INDIA IS GETTING ITS GLORY BACK. HINDUISM IS COMING BACK.

    http://simplecapacity.com/2016/05/artist-uses-brainwaves-manipulate-water-incredible-display-power-human-emotion/

    Thanks
    VKV

    ReplyDelete

  24. Sai
    July 30, 2016 at 10:00 AM
    Guruji,

    one of my friend is having high levels of Homocysteine and recently he got heart stroke.. do high levels of Homocysteine causes stroke. Is there any natural way to bring them down ? Will they raise due Vitamin B?
    Thanks a lot
    Sai

    ReplyDelete
    Replies
    ##################################
    Capt. Ajit Vadakayil
    July 30, 2016 at 2:52 PM
    IMPORTANT:

    WHAT I WRITE NOW WILL NOT BE TAUGHT IN MEDICAL COLLEGES.

    IT IS KEPT A SECRET BY THE HUMPLESS COW LOBBY AND EVIL PHARMA. .

    Most health-conscious people know their cholesterol level but NONE know their equally important homocysteine number.

    THE MEDICAL LOBBY DOES NOT RECOMMEND MEASURING HOMOCYSTEINE LEVELS IN THE BLOOD , AND HAVE KEPT THE COSTS PROHIBITIVE. COSTS ARE NOT COVERED UNDER MEDICAL INSURANCE THANKS TO THE COW LOBBY.

    A2 MILK AND BEEF CAUSES ELEVATED LEVELS OF HOMOCYSTEINE IN THE BLOOD.

    Elevated homocysteine levels cause heart attack, stroke, blood clot formation, and Alzheimer's disease.

    Deep vein thrombosis and pulmonary embolism is caused by elevated homocysteine levels in the body.

    Homocysteine is a naturally-occuring amino acid that is quickly converted to another amino acid called cysteine. If conversion of homocysteine to cysteine is somehow impaired, homocysteine levels rise and become harmful.

    Elevated levels of homocysteine have been linked with a diverse spectrum of health disorders ranging from cardiovascular disease and stroke to migraine, macular degeneration, and cognitive decline.

    Changes in homocysteine levels correlate with changes in mood.

    Almost ALL conventional physicians fail to detect and treat elevated levels of homocysteine in the blood.

    High homocysteine levels in the blood increase LDL cholesterol, which have been associated with damage to the lining of arteries and atherosclerosis (hardening and narrowing of the arteries).

    Homocysteine is an amino acid. Amino acids are the building blocks of proteins. When proteins break down, elevated levels of amino acids like homocysteine may be found in the bloodstream. Having elevated levels of homocysteine in the blood (hyperhomocysteinemia) is associated with atherosclerosis and blood clots.

    It is not possible to get homocysteine from the diet. It must be made from methionine, another amino acid that is found in meat, fish, and dairy products. Vitamins B6 (pyridoxine), B12 and folic acid are needed to make this reaction occur.

    Foods containing methionine are transformed into homocysteine in the bloodstream. Homocysteine is converted in the body to cysteine, with vitamin B6 facilitating this reaction. Homocysteine can also be recycled back into methionine using vitamin B12-related enzymes.

    Cysteine is an important protein in the body that has many roles. It is involved in the way proteins within cells are folded, maintain their shape, and link to each other. Cysteine is a source of sulfide and is part of the metabolism of different metals in the body including iron, zinc and copper. Cysteine also acts as an anti-oxidant.

    If homocysteine cannot be converted into cysteine or returned to the methionine form, levels of homocysteine in the body increase.


    CONTINUED TO 2-

    ReplyDelete
    Replies
    1. CONTINUED FROM 1-

      There is a relationship between the levels of homocysteine in the body and the size of the carotid arteries that supply the brain with blood; the higher homocysteine level, the narrower or more stenosed the carotid artery.

      Alzheimer's disease and other types of dementia may be more frequently seen in patients with increased homocysteine in the blood.

      Elevated homocysteine are associated with some fetal abnormalities and with potential blood vessel problems in the placenta, causing abruption.
      Hyperhomocysteinemia has been classified into moderate, intermediate, and severe types based on the level of homocysteine as follows:

      Moderate (15 to 30 µmol/L)
      Intermediate (30 to 100 µmol/L)
      Severe (greater than 100 µmol/L)

      Normal levels of homocysteine are <11.4 micromoles per liter (mcmol/L) for men and <10.4 mcmol/L for women.

      Even moderate elevations :---
      React with proteins on LDL cholesterol molecules, which may lead to foam cell formation, resulting in plaque buildup.
      Increase stickiness of platelets, leading to clotting.
      Decrease nitric oxide production due to excess oxidative stress.
      Increase the binding of lipoprotein (a) to fibrin, causing increased clotting and development of atherosclerosis.
      Cause decreases in hydrogen disulfide production (H2S acts to protect the endothelium).
      Increase free radical damage to blood vessels

      Again, homocysteine levels increase in the body when the metabolism to cysteine of methionine to cysteine is impaired. This may be due to dietary deficiencies in vitamin B6, vitamin B12, and folic acid. Lowering homocysteine levels decrease the risk of stroke.

      There is a relationship between elevated homocysteine levels and broken bones, especially in the elderly. Read this line twice.

      Amino acids, cysteine and methionine, are unusual because they contain the element sulfur, which plays an important role in determining the shape of new proteins by helping these compounds fold.

      Eat more fruits and vegetables ( organic / NON GM ) . This can help regulate your homocysteine level by increasing how much folate you get in your diet.

      Decrease in weight is correlated with a decrease in homocysteine levels.

      Again, elevated homocysteine levels affect the interior lining of blood vessels in the body, increasing the risk of atherosclerosis or narrowing of blood vessels. This can result in early heart attack and stroke.

      capt ajit vadakayil
      ..

      Delete
    2. Hi Ajit,
      Please correct it and will make confusion " A2 MILK AND BEEF CAUSES ELEVATED LEVELS OF HOMOCYSTEINE IN THE BLOOD"
      We know is as A1 humppless Cow Milk and beef

      Sushanta Das

      Delete
    3. KORREKSHUN:

      A1 MILK IS FROM WESTERN HUMPLESS COW . IT IS TOXIC

      A2 MILK IS FROM VEDIC HUMPED COW . IT IS NUTRITIOUS

      Delete
    4. Hi Ajit,

      Thanks For Korrektion !

      Sushanta Das

      Delete
  25. http://www.femina.in/relationships/love-sex/foreplay-moves-to-master-in-bed-13429.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    CHUTNEY MARYS ALWAYS LOSE THEIR PANTIES IN THE OFFICE TOILET

    THUMBRULE: NEVER LET HITLER CATCH A COLD. ALWAYS CARRY AN EXTRA PANTY IN THE PURSE .

    ReplyDelete
  26. http://www.femina.in/relationships/love-sex/whatre-the-best-times-of-the-day-for-sex-13623.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    FOR CHUTNEY MARYs IT IS THE OFFICE TOILET !

    ReplyDelete
  27. http://timesofindia.indiatimes.com/life-style/relationships/man-woman/New-ways-to-turn-up-the-heat-between-the-sheets/articleshow/53433095.cms

    CHUTNEY MARYS MAKE SURE THEIR BOSSES SACK THE OFFICE PEON EVERY MONTH

    THEY NEED VARIETY OF DIRT

    ReplyDelete
  28. Sir
    This answers a query in previous blogs about what should an individual do to prevent problems


    "Consciousness of people has incredible powers. It can increase order in the world and make it as we wish it to be. If a number of individuals concentrate and wish for the same thing it has even greater force."
    Thanks n best wishes

    ReplyDelete
  29. ONCE THE DEMENTED COCAINE SNORTING ORANGUTAN WAS CRYING ON NEWSHOUR THAT SITARMA YECHURY IS AN INTELLECTUAL GIANT.

    TEE HEE

    JUST SHOWS THE SIZE OF HIS OWN INTELLECT

    ATHEIST COMMIES BEING INTELLIGENT ?

    ReplyDelete
  30. Ajit ji, Is Patanjali Cow Milk powder a good alternative to A2 milk?

    ReplyDelete
  31. hi Captain Sir see this post
    AYODHYA: A lesser known Muslim cleric and leader of Jamiat Ulema Hind, Mufti Mohammad Ilyas Qasmi, stirred up a controversy on Thursday when he referred to Lord Shiva as the first messenger of Islam. Qasmi, a senior leader of the Jamiat who has been propagating Hindu-Muslim unity in Ayodhya, said he backed the RSS view that "every Indian is a Hindu."

    Qasmi elaborated that Muslims were also followers of Sanatan Dharma and "have no reservations in accepting that Lord Shiva and Goddess Parvati were part of the series of a lakh and twenty four thousand prophets sent to Earth with a mission to establish humanity, true religion and God's rule in the world".



    http://timesofindia.indiatimes.com/india/Lord-Shiva-first-messenger-of-Islam-Muslim-cleric-says/articleshow/46306675.cms

    ReplyDelete
  32. Hi Qwerty, No, it is not. All Patanjali Dairy products are made from A1 cows milk.

    ReplyDelete
  33. http://timesofindia.indiatimes.com/india/Concerned-over-reports-of-rising-intolerance-and-violence-in-India-US/articleshow/53463596.cms

    AIYOOOOO DARRR GAYA !

    JOHN KIRBY FUCK OFF !

    RATHER , CATCH AND SWING !

    THE DAYS OF INDIA GETTING FRIGHTENED BY GORA GAAND THREATS IS OVER .

    ReplyDelete
    Replies
    1. Hi Ajit,

      Kiran Majumdar Shaw is sympathetic :https://twitter.com/kiranshaw/status/759283699762532352
      Sushanta Das

      Delete
    2. if this UGLY woman scowls at me --

      I WILL FIRST SHIT IN Me PANTS

      AND THEN I MAY DIE

      Delete
    3. Nonstop false flag massacres in usa and they are scared of India. Except some educated urbanites everyone sees through this.

      Delete
  34. http://blogs.timesofindia.indiatimes.com/toi-editorials/gagging-media-in-kerala-lawyers-join-hands-with-government-to-deny-citizens-right-to-know/?utm_source=TOInewHP_TILwidget&utm_campaign=TOInewHP&utm_medium=Widget_Stry

    BENAMI MEDIA

    DESH DROHIS ALL

    THE JNU EPISODE OPENED OUR EYES

    ReplyDelete
  35. http://hindu-tolerance.blogspot.my/

    ReplyDelete
  36. Sir tell some real truths about this lady called mahasweta devi who was social activist and writer..

    ReplyDelete
  37. THE CARBON CREDIT/ OFFSET THINGY IS THE GREATEST HEIST SINCE WW2, WHERE JEW HITLER WORKING FOR JEW ROTHSCHILD CARVED OUT ISRAEL AND ALSO ELIMINATED THE EFFIMATE GAYS SELECTIVELY.

    OFFSETS ARE A LICENSE TO THE ZIONIST WEST TO POLLUTE AT WILL-- THE MOTHER OF ALL SCAMS

    They claim it is OK to increase emissions if they pay others to reduce them – the so-called “offset” projects. But it is a fallacy that offsets can neutralize the emissions caused elsewhere, especially offsets that involve storage of carbon in forests and soils.

    Emissions need to be cut at the source.

    THE BEEF LOBBY, GM FERTILISER LOBBY, THE NITRO EXPLOSIVES LOBBY ARE WARMING UP THE PLANET WITH NITROUS OXIDE.

    MIND YOU-- THE MOMENT A RESURGENT INDIA POINTS OUT TO THE BEEF /GM LOBBY THE ZIONIST JEWS WILL START NITROGEN CREDITS/ OFFSETS

    There are Zionist intermediaries who are the babies of Zionist Jew corporations that want to become "carbon-neutral" by purchasing offsets for the carbon dioxide they release.

    YOU DUMP METHANE/ NITROUS OXIDE AND THEN CRUNCH NUMBERS AND MAKE MONEY OUT OF THIN AIR.

    SEE I FARTED 200 TIMES--

    YEH LEH PAISA. TUM THODA KUM FART MAARO ( KAAGAZ KE OPAR )

    THIS IMMORAL CARBON SCAM IS LIKE A HOMOSEXUAL PEDOPHILE KEEPING OUT OF JAIL , BY SAYING THAT HE BOUGHT ASSHOLE HUMPING CREDITS

    MAATHARCHOD Al Gore has a large interest in a firm that sells carbon credits

    why is India planting bullshit trees, APCO Modi ? who has authorised rogues like Sadguru Jaggi Vasudev to planet trees which lower the ground water table --so that he can get an entry into Guinness book of world records ?

    ROTHSCHILDs US FEDERAL RESERVE MAKES MONEY OUT OF THIN AIR

    NOW THEY MAKE MORE MONEY FROM THIN AIR WITH THIS CARBON HEIST

    http://ajitvadakayil.blogspot.in/2011/01/murky-truths-of-inflation-and.html

    http://ajitvadakayil.blogspot.in/2011/02/worth-more-than-sum-total-of-entire.html

    capt ajit vadakayil
    ..

    ReplyDelete
  38. http://ajitvadakayil.blogspot.in/2016/07/sanatana-dharma-hinduism-exhumed-and_31.html

    I WANT ALL MY READERS TO READ THE POST ABOVE AGAIN

    BAD DAYS HAVE STARTED FOR SRI SRI RAVISHANKAR . .

    NEXT TIME HE GOES TO SOUTH AMERICA AND A COUPLE OF COUNTRIES IN EUROPE THERE ARE ANGRY PEOPLE WHO WILL GET HIM ARRESTED FOR CAUSING BRAIN DAMAGE DUE TO HYPERVENTILATION ( SUDARSHAN KRIYA- SO HUM )

    ReplyDelete
  39. STOP PRESS :

    kancha ilaih SQUEAK nay shephard came on TV couple of years ago.

    he was cracking up from within-- his voice quivered with sheer grief when he cried--THESE HINDU GODS ARE SO VIOLENT, THEY ARE ALL THE TIME KILLING PEOPLE

    to this SQUEAK i must say " hindus gods are all cosmic allegories except vishnu avatars "

    stop moaning that Brahmins did NOT allow shudras to learn vedas – this would be as irresponsible as a brain surgeon allowing his nurse to do brain surgery on a holiday .. vedas went on the oral route for 300 centuries, without losing a syllable , before they were penned down 70 centuries ago ..

    CONDENSATION DOES NOT KILL EVAPORATION--THIS IS A CONCEPT MEANT FOR THE WISE--NOT IDIOTS.

    http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html
    devdutt pattanaik who does NOT understand sanatana dharama comes on TV serials aand denigrated hindusim.

    he thinks that hindu gods are mortals , and their vahanas ( vimanas ) animals and birds.

    see the way amish tripati converted shiva to be a tribal sex started mortal and the white man loved him for it.

    devdutt pattanaik's attitude towards hinduism can be gauged from the post below--

    read the part n blue italics- where shiva is hiding from nandi bull who is waiting in ambush to rape shiva anally . . . reciprocation if you please . .

    http://ajitvadakayil.blogspot.in/2014/01/nandi-bull-vahana-and-gatekeeper-of.html

    if he did the same in saudi arabia to islam he would have been beheaded on the streets within an hour.

    this blogsite asks TIMES OF INDIA e-newspaper to stop denigrating Hinduism daily vide its SPIRITUALITY COLUMN.

    devdutt pattanaik must know there is no heaven and hell in Hinduism.

    somebody asked me about old people-- even from kerala-- going to KASHI GHATS to die.

    well in olden days due to the saraswati river underground component, there was a MOBIUS COIL water flow at the ghats . people whose souls departs from this massive SCALAR FIELD gets a boost of ONE astral layer

    same with kailash mountain-- pandavas walked to mount kailash before they died.

    pyramid shaped mount kailash has an ORGONE FIELD due to the golden mean of 1.618 .

    http://ajitvadakayil.blogspot.in/2010/12/secrets-of-egyptian-pyramids-revealed.html

    THIS BLOGSITE WARNS JNU COMMIE PROFESSORS, NOT TO COOK UP FALSE STORIES ABOUT SANATANA DHARMA . .

    WE DONT WANT COMMIES TO SAVE INDIA..

    capt ajit vadakayil
    ..

    ReplyDelete
  40. http://zeenews.india.com/cricket/woah-yuvraj-singh-takes-down-shobhaa-de-and-her-ilk-with-these-scathing-remarks_1926420.html

    I NEVER LIKED YUVRAJ SINGH

    BUT NOW I LIKE HIM . .

    HOW MANY SCHOOLS IN INDIA HAVE A PLAYGROUND ? FORGET ABOUT SWIMMING POOL . .

    THE BLOGSITE IS GRATEFUL TO DIPA KARMAKAR FOR SHOWING INDIA , THAT WE CAN DO IT

    I HAVE DONE IN MY OWN WAY , BY A BLOGSITE TO SHOW INDIANS , THAT WE MUST BE PROUD OF OURSELVES --THAT WE CAN DO IT

    DIPA KARMAKAR HAS FIRED THE IMAGINATION OF INDIANS-- LIKE NO ATHLETE EVER BEFORE

    SHOBHAA DE CALLS HERSELF THE NO 1 WRITER IN INDIA USING HER WESTERN CONTACTS.

    SHE HAS A PROPAGANDA MACHINE THAT HER PUERILE SEXUAL SLIME LOADED BOOKS ARE COURSE MATERIAL IN LONDON UNIVERSITY.

    https://twitter.com/DeShobhaa/status/772050093398757376

    OH YEAH ?

    THIS FRENCH WINE ( ON KNEES ) LOVING WOMAN HAS A PROFILE VIEW OF 1.3 LAKHS , THOUGH I STARTED BLOGGING 3 YEARS AFTER HER

    https://www.blogger.com/profile/05610708004901279105

    HERE IS MINE -- 50.1 LAKHS

    https://www.blogger.com/profile/14410812789424637654

    PROOF OF THE PUDDING LIES IN THE EATING -- NOT PROPAGANDA SHIT

    THIS KALANK TO INDIAN WOMANHOOD SHOBHAA DE IS ONE OF THE MOST HATED WOMEN IN INDIA . .

    ReplyDelete

  41. தென்னவன்

    September 10, 2016 at 4:47 PM

    RSS is now calling Onam as VAAMANA JAYANTHI


    ############################
    Capt. Ajit Vadakayil
    September 10, 2016 at 6:08 PM

    hi t,

    IF IT IS VAMANA JAYANTI, THE REST OF INDIA ( EXCEPT KERALA ) SHOULD CELEBRATE IT . . .

    VISHU AS VAMANA BANISHED MAHABALI ONLY BECAUSE HE DID ASHWAMEDHA YAGNA SUCCESSFULLY UNDER INSTIGATION BY SHUKRACHARYAs. . . .

    THIS IS SHUKRACHARYAs ( MENTOR OF ASURAS ) VICTORY --

    BITTER RIVAL BRIHASPATIs SON KACHA HAD DONE FOUL AND IMMORAL LOVE JIHAS ON SHUKRACHARYs DAUGHTER DEVYANI . . THERE WAS ENDLESS ENMITY . .

    THE WHOLE WORLD AT A TIME MILLENNIUMS AGO WERE DIVIDED BETWEEN SHUKRACHARYA WORSHIPERS AND WORSHIPERS BITTER RIVAL BRIHASPATI ( MENTOR OF DEVAS )

    SHUKRACHARYA WORSHIPERS HAD FRIDAY AS HOLIDAY AND BRIHASPATI WORSHIPPERS HAD THURSDAY AS HOLIDAY . . .

    SHUKRACHARYA WAS REJECTED AS MENTOR OF DEVAS THOUGH HE WAS BETTER THAN GURUKUL CLASSMATE BRIHASPATI IN EVERY RESPECT --

    BRIHASPATIs FATHER MAHARISHI ANGIRASA WAS A GREAT GURU AND HENCE DEVAS CHOSE BRIHASPATI AS THEIR MENTOR OVER SHUKRACHARYA, THOUGH SHUKRACHARYA WAS MILES AHEAD OF BRIHASPATI , EVERY WHICH WAY . .

    WE IN KERALA DO NOT CELEBRATE DIWALI AS THIS IS MEANT TO CELEBRATE THE VICTORY OF DEVAS OVER ASURAS.

    INSTEAD WE CELEBRATE ONAM IN GRATITUDE TO A GREAT A BELOVED ASURA RULER KING MAHABALI .. ONAM IS CELEBRATED BY KERALA MUSLIMS AND CHRISTIANS TOO ..

    THERE IS NO RELIGIOUS DIVIDE IN KERALA OVER ONAM , IT IS AMAZING ..

    ATHEIST COMMIES LIKE PINARAYI VIJAYAN ( CM OF KERALA ) IS TRYING TO SUPRESS ONAM . . ONAM DISRUPTS THEIR COMMIE ANTI-WATAN AGENDA . . .

    http://ajitvadakayil.blogspot.in/2011/09/why-kerala-does-not-celebrate-diwali-or.html

    PARSIS CALL THEIR GODS ASURAS ( AHURA ) AND VICE VERSA.

    PARSIS CANT PRONOUNCE S --THEY INSERT H.

    LIKE HOW CHINESE AND JAPANESE SUBSTITUTE L FOR R AND VICE VERSA . . .

    http://ajitvadakayil.blogspot.in/2012/05/thor-zeus-marduk-brihaspati-and-jupiter.html

    WESTERN PEOPLE STILL WORSHIP BRIHASPATI AS ZEUS , THOR etc . .

    http://ajitvadakayil.blogspot.in/2012/05/thor-zeus-marduk-brihaspati-and-jupiter.html

    FESTIVALS CELEBRATED FROM YORE , NEVER LIE ..

    capt ajit vadakayil
    ..

    ReplyDelete
  42. http://timesofindia.indiatimes.com/city/lucknow/Puri-Shankaracharya-claims-computers-have-origin-in-Vedas/articleshow/54944097.cms

    ############### SUBJECT --- HAJAAAAAR RIDICULE BECAUSE URI SHANKARACHARYA SAID THAT COMPUTERS HAVE ORIGIN IN VEDAS #############

    Boolean logic is fundamental to the design of computer hardware and programming.

    Today when I think that BOOLEAN LOGIC was lifted from Rig Veda ( 10.129 ) ( the easier ones explained by simple four circles of catuskoti: "A", "not A", "A and 'not A'", and "not A and not not A") penned down 7000 years ago, after 30 milliniums on oral ( sruti ) route , my body hairs stand up.

    JEW George Boole ( died 1864) was an English mathematician, philosopher and logician. He married the Mary Everest , the niece of Rothschild’s agent Colonel Sir George Everest the Surveyor General of India for 14 years from 1830 through 1843.

    JEW Boole baby LIED that this amazing clear thinking theory is his own.

    George Boole is NO genius--

    He is an ordinary thief, stole from ancient India.

    Just like Albert Einstein or Isaac Newton and hundreds like them.

    Mary Everest Boole wrote that her husbands logic was lifted from Indian logic.

    QUOTE: Think what must have been the effect of the intense Hinduizing of three such men as Babbage, De Morgan, and George Boole on the mathematical atmosphere of 1830–65. What share had it in generating the Vector Analysis and the mathematics by which investigations in physical science are now conducted?--: UNQUOTE

    There are quite a few different types of logic gate, the most common of which are called AND, OR, NOT, XOR (Exclusive Or), NAND (NOT AND), and NOR (NOT OR) seven basic logic gates ease the complexity of Boolean algebra and allow for simple application in electronics and circuit analysis.

    Seven blind men and an elephant (Andhgajanyayah), addresses the manifold nature of truth. In Sanatana Dharma there is no place for DOGMA .

    Vedic LOGIC was of seven types ( philosophy )

    syād-asti,
    syān-nāsti,
    syād-asti-nāsti,
    syād-asti-avaktavyaḥ,
    syān-nāsti-avaktavyaḥ,
    syād-asti-nāsti-avaktavyaḥ,
    syād-avaktavyaḥ— in some ways, it is indescribable.

    today the story of seven blind men and the elephant has been stolen by the white man--though he has no elephants in his own country . . TEE HEEEEE .

    Using combinations of logic gates, complex operations can be performed. In theory, there is no limit to the number of gates that can be arrayed together in a single device. But in practice, there is a limit to the number of gates that can be packed into a given physical space. Arrays of logic gates are found in digital integrated circuits (ICs).

    There are seven logic gates: NOT, AND, OR, NAND, XOR, NOR, XNOR

    The AND gate is so named because, if 0 is called "false" and 1 is called "true," the gate acts in the same way as the logical "and" operator The output is "true" when both inputs are "true." Otherwise, the output is "false."

    The OR gate gets its name from the fact that it behaves after the fashion of the logical inclusive "or." The output is "true" if either or both of the inputs are "true." If both inputs are "false," then the output is "false."

    The XOR ( exclusive-OR ) gate acts in the same way as the logical "either/or." The output is "true" if either, but not both, of the inputs are "true." The output is "false" if both inputs are "false" or if both inputs are "true." Another way of looking at this circuit is to observe that the output is 1 if the inputs are different, but 0 if the inputs are the same.

    A logical inverter , sometimes called a NOT gate to differentiate it from other types of electronic inverter devices, has only one input. It reverses the logic state.

    ReplyDelete
    Replies
    1. CONTINUED FROM 1--

      The NAND gate operates as an AND gate followed by a NOT gate. It acts in the manner of the logical operation "and" followed by negation. The output is "false" if both inputs are "true." Otherwise, the output is "true."

      The NOR gate is a combination OR gate followed by an inverter. Its output is "true" if both inputs are "false." Otherwise, the output is "false."

      The XNOR (exclusive-NOR) gate is a combination XOR gate followed by an inverter. Its output is "true" if the inputs are the same, and"false" if the inputs are different.


      Dimitri Mendeleyeev had admitted in writing that his PERIODIC TABLE is lifted from the Sanskrit alphabets of Panini.

      Panini’s grammar includes early use of Boolean logic, of the null operator, and of context free grammars, and includes a precursor of the “Backus–Naur” form (used in the description programming languages) .

      Panini lived 7500 years ago. The white invader kicked him forward in time as the Big Bang of the bible was only in 4004 BC.

      Boolean Algebra served the basis of early transistors and capacitors used in early primitive form of the computer.

      The tetralemma is lifted from ancient Indian math.
      It states that with reference to any a logical proposition X, there are four possibilities:

      X (affirmation)
      \neg X (negation)
      X \land \neg X (both) equiv.
      \neg (X \lor \neg X) (neither)

      The catuṣkoṭi is a "four-cornered" system of argumentation that involves the systematic examination and rejection of each of the 4 possibilities of a proposition,

      All things (dharmas) exist: affirmation of being, negation of nonbeing
      All things (dharmas) do not exist: affirmation of nonbeing, negation of being
      All things (dharmas) both exist and do not exist: both affirmation and negation
      All things (dharmas) neither exist nor do not exist: neither affirmation nor negation

      The history of fourfold negation, the Catuskoti (Sanskrit), is evident in the logico-epistemological tradition of the 7000 year old Upanishads.

      P; that is, being.
      not P; that is, not being.
      P and not P; that is, being and not being.
      not (P or not P); that is, neither being nor not being.

      George Boole and Augustus De Morgan make their pioneering applications of algebraic ideas to the formulation of logic (such as Algebraic logic and Boolean logic), from the Vedic sutras written down 7000 years ago.

      By combining Boolean logic with ancient Vedic mathematics, substantial amount of iteration were eliminated that resulted in 45% reduction in delay and 30% reduction in power compared with the mostly used (Digit Recurrence, Convergence & Series Expansion) architectures


      Truth tables can be used to tell whether a propositional expression is true for all legitimate input values, that is, logically valid. In digital electronics, Boolean logic refers to the manipulation of binary values in which a 1 represents the concept of true and a 0 represents the concept of false

      MY SON WHO DID HIS COMPUTER SCIENCE MASTERS IN CORNELL USA, TOLD ME— THIS IS ALL THERE IS TO COMPUTER SOFTWARE CODING …

      SO ALL CHUTNEY MARYs , PICKLE HOHNs AND WANNABE GORA GAANDS CAN CATCH AND SWING !

      AND SWING GOOD . ...

      capt ajit vadakayil
      ..

      Delete
  43. Nelson Singh
    December 2, 2016 at 4:14 PM

    Sir does dark energy behaves like a fluid and has negative pressure ??

    goo.gl/VnMXeT

    ReplyDelete
    Replies
    ##############################
    Capt. Ajit Vadakayil
    December 2, 2016 at 7:57 PM

    Vivekananda told Nikola Tesla about AKASHA.

    Akasha ( ether ) is the foundation of Vaastu.

    Every thought is manifested in the ether before it is manifested in the material world. The ether holds the Cosmos together and is the “space” where imaginary, past, present, and future information are stored.

    During REM sleep we access Akashik records

    In other words, no one has discovered anything, because the thing that they “discovered” has already existed in the ether.

    NO HUMAN BEING INVENTED OR DISCOVERED ANYTHING TILL TODAY. YOU ARE NOT YOUR BODY—YOU ARE THE BALL OF ENERGY WITHIN YOU ( SOUL ).

    SOUL KNOWS EVERYTHING

    SOUL WAS SENT DOWN BY BRAHMAN , ( THE MOTHER FIELD OF CONSCIOUSNESS FROM THE SEVENTH ASTRAL LAYER ) BY SHEARING OFF PARTS OF HIS ITS BODY AND SENT DOWN ON EARTH AFTER REDUCING ITS FREQUENCY.

    One day after you get Moksha , your soul will merge back with the mother field of Brahman, and give back all its experience . Brahman knows everything.

    Do not ever think that scientists sitting in ISRO used their brains to send a rocket to Mars. Their souls did it.

    MODERN SCIENTISTS CALL AKASHA , DARK ENERGY

    From the ether emerges the other elements, which are space (expansiveness and infinity), air (mobility), fire (temperature), water (fluidity), and earth (solidity)—the PANCH BHOOTAS of Vaastu.

    These five elements are not based on physical qualities but spiritual qualities. Because everything in the material world emerges from the ether, without it the material world will vanish into nothingness.
    Aakasha ( ether ) is a great cosmic mass of eternal forces of vibration. It is made up of both destructive vibrations and constructive vibrations. Opposing forces Brahma and Shiva are mediated by Vishnu.

    This has been mentioned in the RIG VEDA penned down 70 centuries ago, after 300 centuries on the oral route

    http://ajitvadakayil.blogspot.in/2014/07/nasadiya-sukta-rig-veda-5000-bc.html

    THERE IS ZERO SUPERSTITION IN SANATANA DHARMA

    SCIENCE WILL TAKE ANOTHER 500 YEARS TO CATCH UP WITH VEDANTA

    The space between the planets is very much alive, that it is the highest form of vibration known, the vibrations of THOUGHT.

    Human INTENTION is a wonderful thing

    http://ajitvadakayil.blogspot.in/2010/04/vedic-quantum-intention-experiment.html

    WHAT DO ALL THESE NON –TECHNICAL PEOPLE LIKE BR AMBEDKAR, EVR PERIYAR, MAHATMA PHULE SSAB, PANSARE, KALBURGI, BHABHOLKAR, UR ANANTHAMURTY, KANCHA ILAIY SQUEAK etc KNOW?

    Makarishis with 12 strand DNA and king sized pineal glands accessed Akasha at will . Akasha ( ether ) is all pervading. We access akasha at will through thinking but some gifted people can access it at higher levels.

    Sometimes when I say, I get info from my GENOME—what do I mean ?

    Every idea ever known to man is stored in the AKASHIC RECORDS

    EVIL PHARMA IS HELL BENT ON DEPRIVING MAN OF REM SLEEP

    When you get proper REM sleep you can acquire great ideas, inventions and mathematical and scientific blue prints that form these inventions.

    Every human brain communicates with Infinite Intelligence… but only a few know how to master it…

    https://www.youtube.com/watch?v=QAa2O_8wBUQ

    More than 70% of the cosmos is dark energy.

    Dark matter makes up about 26%. The rest - everything on Earth, everything ever observed with all of our instruments, all normal matter - adds up to less than 4% of the universe

    JEW Albert Einstein stole from the 7000 year old Vedas when he wrote that empty space is not nothing-rather it is a plenum.

    Dark energy is a dynamical energy fluid

    capt ajit vadakayil
    ..

    ReplyDelete
  44. http://www.inquisitr.com/3764223/stephen-hawking-warns-humanity-about-donald-trump-we-are-at-most-dangerous-moment-in-history-video/

    CAPT AJIT VADAKAYIL DECLARES

    STEPHEN HAWKINGS HAS DONE NOTHING FOR THIS PLANET .

    HIS USELESS THEORIES ARE HYPED UP BY JEW ROTHSCHILD-- JUST BECAUSE HE SUPPORTS PEA BRAIN JEW ALBERT EINSTEIN--A THIEF

    http://ajitvadakayil.blogspot.in/2014/08/yellapragada-subbarow-nobel-prize-and.html

    ALL OF JEW EINSTEINs MATH WAS OUTSOURCED TO INDIA..

    http://ajitvadakayil.blogspot.in/2011/11/satyendranath-bose-nobel-prize-and.html

    A REAL GENIUS WAS NIKOLA TESLA

    HE INVENTED AC ELECTRICITY AND MOTORS

    TESLA MADE ON DENT ON THIS PLANET

    BEFORE THE INTERNET AGE , NOBODY HEARD OF TESLA

    MY FIRST BLOGPOST WAS ABOUT TESLA --TODAY MY BLOGPOSTS NUMBER 1090 .

    I HAVE COVERED ALMOST EVERY SUBJECT ON THIS PLANET .

    I AM TODAY THIS PLANETs NO 1 WRITER --IN QUANTITY, AS WELL AS QUALITY

    IF ANYBODY HAS WRITTEN MORE WORDS ON THIS PLANET , LET ME KNOW. ( INCLUDE ONE LAKH SEVENTY THOUSAND COMMENTS TOO )

    I GUESS I HAVE NIKOLA TESLAs BLESSINGS -- HE WAS DELETED BY JEW ROTHCHILD

    A THIEF NAMES EDISON WAS PUSHED AHEAD BY JEW ROTHSCHILDs HISTORIANS -- A SON OF A BITCH !

    http://ajitvadakayil.blogspot.in/2010/11/edison-ace-delegator-cum-patent.html

    capt ajit vadakayil
    ..

    ReplyDelete