Tuesday, July 19, 2016

SANATANA DHARMA , HINDUISM EXHUMED AND RESURRECTED, PART 53 - CAPT AJIT VADAKAYIL



THIS POST IS CONTINUED FROM PART 52 , BELOW-




NONE OF THE SO CALLED ANCIENT CIVILIZATIONS OF THE PLANET HAVE LEFT BEHIND ANYTHING OF CEREBRAL VALUE IN WRITING-- ABSOLUTELY  NOTHING !!     

80% OF OUR VEDAS ( SAMHITAS/ BRAHMANAS/ ARANYAKAS/ UPANSIHADS) HAVE BEEN STOLEN / DESTROYED BY THE WHITE INVADER.    

THE JEALOUS WHITE MAN  POST DATED OUR ANCIENT WORKS PENNED DOWN IN 5000 BC,   TO SUIT THEIR UNDERSTANDING OF BIG BANG DATED AT A RIDICULOUS 4004 BC.    

IN THIS INTERNET AGE, IT IS PAY BACK TIME !   

THE WORLD SHALL KNOW THE GLORY OF ANCIENT INDIA  !! 




CHECK OUT THE SOUND OF  PATANJALIs YOGA SUTRAS PENNED DOWN 7000 YEARS AGO, WHEN THE REST OF THE WORLD WERE RUNNING AROUND NAKED DOING GRUNT GRUNT




CHAPTER I-  SAMADHI PADA-   CONTEMPLATION
atha yoganushasanam
yogashchittavrittinirodhah
tada drashtuh svaroope avasthanam
vrittisaroopyam itaratra
vrittayah pangchatayyah klishta aklishtah
pramannaviparyayavikalpanidrasmritayah
pratyakshanumanagamah pramanani
viparyayo mithyajnanam atadroopapratishtham
shabdajnaananupati vastushoonyo vikalpah
abhavapratyayalambana vrittirnidra
anubhootavishayasanpramoshah smritih
abhyasavairagyabhyan tannirodhah
tatra sthitau yatno abhyasah
sa tu dirghakalanairantaryasatkarasevito dridha-bhoomih
drishtanushravikavishayavitrishnnasy vashikarasamjna vairagyam
tatparan purushakhyatergunnavaitrishnyam
vitarkavicharanandasmitaroopanugamatsanprajnatah
viramapratyayabhyasapoorvah sanskarashesho anyah
bhavapratyayo videhaprakritilayanam
shraddhaviryasmritisamadhiprajnapoorvaka itaresham
tivrasanveganam aasannah
mridumadhyadhimatratvat tatopi visheshah
eeshvarapranidhanad va
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah
tatra niratishayan sarvajntvabijam
sa poorvesham api guruh kalenanavachchhedat
tasya vachakah prannavah
tajjapastadarthabhavanam
tatah pratyakchetanadhigamopyantarayabhavashch
vyadhistyanasanshayapramadalasyaviratibhrantidarshanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah
duhkhadaurmanasyanggamejayatvashvasaprashvaavikshepasahabhuvah
tatpratishedhartham ekatattvabhyasah
maitreekarunamuditopekshanansukhaduhkhapunyapunyavishayananbhavanatashchittaprasadanam
prachchhardanavidharanabhyan va prannasya
vishayavati va pravrittirutpanna manasah sthitinibandhini
vishoka va jyotishmati
vitaragavishayan va chittam
svapnanidrajnanalambanan va
yathabhimatadhyanad va
paramanu paramamahattvantosya vashikarah
ksheennavritterabhijatasyevmanergrahitrigrahannagrahyeshutatsthatadangjanatasamapattih
tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih
smritiparishuddhausvaroopashoonyevarthamatranirbhasa nirvitarka
etayaiva savichara nirvichara cha sookshmavishaya vyakhyata
sookshmavishayatvan chalinggaparyavasanam
ta eva sabijah samadhih
nirvicharavaisharadye adhyatmaprasadah
rtanbhara tatr prajna
shrutanumanaprajnabhyam anyavishayaa vishesharthatvat
tajjah sanskaro nyasanskarapratibandhi
tasyapi nirodhe sarvanirodhannirbijah samadhih

CHAPTER II - SADHANA PADA-- PRACTISE

tapahsvadhyayeshvarapranidhanani kriyayogah
samadhibhavanarthah kleshatanookaranarthashch
avidyasmitaragadveshabhiniveshah kleshaah
avidya kshetram uttareshanprasuptatanuvichchhinnodaranam
anityashuchiduhkhanatmasunityashuchisukhatmakhyatiravidya
drigdarshanashaktyorekatmatevasmita
sukhanushayi raagah
duhkhanushayi dveshah
svarasavahi vidushopi tatharoodho bhiniveshah
te pratiprasavaheyah sookshmah
dhyanaheyastadvrittayah
kleshamoolah karmashayodrishtadrishtajanmavedaniyah
sati moole tadvipako jatyayurbhogah
te hladaparitapafalah punyapunyahetutvat
parinamatapasanskaraduhkhairgunnavritti -virodhaccha duhkham eva sarvan vivekinah
heyan duhkham anagatam
drashtridrishyayoh sanyogo heyahetuh
prakashakriyasthitishilan bhootendriyatmakanbhogapavargarthan drishyam
visheshavisheshalinggamatralinggani gunnaparvani
drashta drishimatrah shuddhopi pratyayanupashyah
tadarth eva drishyasyatma
kritarthan prati nashtam apyanashtantadanyasadharannatvat
svasvamishaktyoh svaroopopalabdhihetuh sanyogah
tasya heturavidya
tadabhavat sanyogabhavo hanan taddrisheh kaivalyam
vivekakhyatiraviplava hanopayah
tasya saptadhaa prantabhoomih prajna
yogangganushthanad ashuddhikshaye jnanadiptira vivekakhyateh
yamaniyamasanapranayamapratyaharadharanadhyanasamadhayo-a-shtava anggani
ahinsasatyasteyabrahmacharyaparigraha yamah
jatideshakalasamayanavachchhinnahsarvabhauma mahavratam
shauchasantoshatapahsvadhyayeshvarapranidhanani niyamah
vitarkabadhane pratipakshabhavanam
vitarkaa hinsadayah kritakaritanumoditalobhakrodhamohapoorvakamridumadhyadhimatra duhkhajnananantafala itipratipakshabhavanam
ahimsapratishthayam tatsannidhau vairatyagah
satyapratishthayam kriyafalashrayatvam
asteyapratishthayam sarvaratnopasthanam
brahmacharyapratishthayam viryalabhah
aparigrahasthairye janmakathantasanbodhah
shauchat svanggajugupsa parairasansargah
sattvashuddhisaumanasyaikagryendriyajayatmadarshanayojnatvani cha
santoshad anuttamah sukhalabhah
kayendriyasiddhirashuddhikshayat tapasah
svadhyayad ishtadevatasanprayogah
samadhisiddhirishvarapranidhanat
sthirasukham aasanam
prayatnashaithilyanantasamapattibhyam
tato dvandvanabhighatah
tasmin sati shvasaprashvasayorgativichchhedah pranayamah
bahyabhyantarastambhavrittihdeshakalasankhyabhih paridrishto dirghasookshmah
bahyabhyantaravishayakshepi chaturthah
dharanasu ch yojnata manasah
svasvavishayasanprayoge chittasy svaroopanukarivendriyanan pratyaharah

CHAPTER III – VIBHOOTI PADA - MANIFESTATION

deshabandhashchittasya dharana
tatra pratyayaikatanata dhyanam
tad evarthamatranirbhasan svaroopashoonyam iva samadhih
trayam ekatra sanyamah
tajjayat prajnaalokah
tasya bhoomishu viniyogah
trayam antaranggan poorvebhyah
tad api bahiranggan nirbijasy
vyutthananirodhasanskarayorabhibhavapradurbhavaunirodhakshannachittanvayo nirodhaparinamah
tasya prashantavahita sanskarat
sarvarthataikagratayoh
kshayodayau chittasyasamadhiparinamah
tatah punah shantoditau tulyapratyayauchittasyaikagrataparinamah
etena bhootendriyeshu dharmalakshanavasthaparinama vyakhyatah
shantoditavyapadeshyadharmanupati dharmi
kramanyatvan parinamanyatve hetuh
parinamatrayasanyamadatitanagatajnanam
shabdarthapratyayanam itaretaradhyasat sankarahtatpravibhagasanyamat sarvabhootarutajnanam
sanskarasakshatkaranat poorvajatijnanam
pratyayasy parachittajnanam
na cha tat salambanan,tasyavishayibhootatvat
kayaroopasanyamat tadgrahyashaktistambhe chakshuhprakashasanprayogentardhanam
etena shabdadyantardhanamuktam
sopakraman nirupakraman cha karma tatsanyamad aparantajnanam,
arishtebhyo va
maitryadishu balani
baleshu hastibaladini
pravrittyalokanyasat sookshmavyavahitaviprakrishtajnanam
bhuvanajnanan soorye sanyamat
chandre taravyoohajnanam
dhruve tadgatijnanam
nabhichakre kayavyoohajnanam
kanthakoope kshutpipasanivrittih
koormanadyan sthairyam
moordhajyotishi siddhadarshanam
pratibhad va sarvam
hridaye chittasanvit
sattvapurushayoratyantasankeernnayohpratyayavishesho bhogah pararthatvat
svarthasanyamat purushajnanam
tatah pratibhashravannavedanadarshasvadavarta jayante
te samadhavupasargaa vyutthane siddhayah
bandhakarannashaithilyat pracharasanvedanach chchittasya parashariraveshah
udanajayajjalapangkakantakadishvasangg utkrantishch
samanajayat prajvalanam
shrotrakashayoh sanbandhasanyamad divyan shrotram
kayakashayoh sanbandhasanyamalaghutoolasamapatteshchakashagamanam
bahirakalpita vrittirmahavideha tatahprakashavarannakshayah
sthoolasvaroopasookshmanvayarthavattvasamyamadbhootajayah
tatoanimadipradurbhavah kayasanpattaddharmanabhighatashch
roopalavanyabalavajrasanhananatvani kayasanpat
grahannasvaroopasmitanvayarthavattvasanyamad indriyajayah
tato manojavitvan vikarannabhavah pradhanajayashch
sattvapurushanyatakhyatimatrasysarvabhavadhishthatritvam sarvajnatritvan cha
tadvairajnadapi doshabijakshaye kaivalyam
sthanyupanimantrane sanggasmayakarannanpunah anishtaprasanggat
kshannatatkramayoh sanyamadavivekajam jnanam
jatilakshannadeshairanyataanavachchhedattulyayostatah pratipattih
tarakan sarvavishayan sarvathavishayam akramancheti vivekajan jnanam
sattvapurushayoh shuddhisamye kaivalyam iti

CHAPTER IV--  KAIVALYA PADA --  LIBERATION

janmaushadhimantratapahsamadhijah siddhayah
jatyantaraparinamah prakrityapoorat
nimittam aprayojakan prakritinan varannabhedastutatah kshetrikavat
nirmannachittanyasmitamatrat
pravrittibhede prayojakam chittam ekam anekesham
tatra dhyanajam anashayam
karmashuklakrishnnam yoginah trividham itaresham
tatastadvipakanugunanam evabhivyaktirvasananam
jatideshakalavyavahitanam apyanantaryamsmritisanskarayoh ekaroopatvat
tasam anaditvam chashisho nityatvat
hetufalashrayalambanaih sangrihitatvad eshamabhave tadabhavah
atitanagatan svaroopatostyadhvabhedad
te vyaktasookshma gunatmanah
parinamaikatvad vastutattvam
vastusamye chittabhedat tayorvibhaktah panthah
taduparagapekshatvat chittasya vastu jnatajnatam
sada jnatashchittavrittayastatprabhohpurushasyaparinamitvat
na tat svabhasandrishyatvat
ekasamaye chobhayanavadharannam
chittantaradrishye buddhibuddheratiprasanggah smritisankarashcha
chiterapratisankramayastadakarapattausvabuddhisanvedanam
drashtridrishyoparaktan chittan sarvartham
tadasankhyeyavasanachitram api pararthan sanhatyakaritvat
visheshadarshin aatmabhavabhavanavinivrittih
tada vivekanimnan kaivalyapragbharan chittam
tachchhidreshu pratyayantarani sanskarebhyah
hanam esham kleshavaduktam
prasankhyanepyakusidasy sarvathavivekakhyaterdharmameghah samadhih
tatah kleshakarmanivrittih
tada sarvavarannamalapetasyjnanasyaanantyajgyeyam alpam
tatah kritarthanan parinamakramapari samaptirgunanam
kshannapratiyogi parinamaparantanigrarhyah kramah

purusharthashoonyanan gunanan pratiprasavahkaivalyan, svaroopapratishtha va chitishaktireti





The Yoga Sutras were penned down in 5000 BC by Maharishis Patanjali-- 196 Sanskrit sutras (aphorisms). Patanjali divided his Yoga Sutras into four chapters.



HALFWITS WHO READ THE SRUTI VERSES OF THE VEDAS ( SAMHITA -FIRST PART OUT OF FOUR PARTS ) RANTED THAT THE SANSKRIT VERSES ARE NONSENSE.  

WELL, THESE VERSES ARE FOR SONIC MAGIC AND THE MEANING OF WORDS JUST PUT YOU IN A GRATEFUL DISPOSITION FOR THE MAGIC TO HAPPEN . 

WE INDIANS WERE NOT IDIOTS TO PASS THESE VERSES DOWN ORALLY FOR 300 CENTURIES BEFORE WE PENNED IT DOWN 70 CENTURIES AGO  . . 



THE SRUTI PART TWO ( BRAHMANAS )  THREE (ARANYAKAS ) AND FOUR (UPANISHADS )  RATTLED THE WORLD -- WHEN THE WHOLE WORLD WAS DOING GRUNT GRUNT FOR LANGUAGE -   HERE WAS A CIVILIZATION IN FULL CEREBRAL BLOOM.



Sir
Put Che Guevara and one more great mind Pjotr Garajajev(Russian Biophysicist) in Vadakayil's list.

regards




  1. hi gb,

    today modern science is getting to know how sanskrit mantras affect DNA.

    Sanskrit has emanated from human DNA.

    DNA have set rules just like Sanskrit .

    Pjotr Garjajev wrote- “Living chromosomes function just like solitonic/holographic computers using the endogenous DNA laser radiation.”

    He modulated certain frequency patterns onto a laser ray and with it influenced the DNA frequency and thus the genetic information itself. Since the basic structure of DNA-alkaline pairs and of Sanskrit are of the same structure, no DNA decoding is necessary.

    Sanskrit is the only divine language on this planet. DNA reacts to Sanskrit mantras.

    Genetic defects including homosexuality can be repaired by Sanskrit mantras.

    Chromosomes damaged by x-rays can be repaired. Russians captured information patterns of a particular DNA and transmitted it onto another, thus reprogramming cells to another genome.

    They have transformed, frog embryos to salamander embryos simply by transmitting the DNA information patterns!

    Entire information was transmitted without any of the side effects or disharmonies encountered when cutting out and re-introducing single genes from the DNA. This shocking discovery was known to ancient Indians and written down 7000 years ago.

    There is amazing power in the longitudinal waves of Sanskrit mantras. Wave genetics, has an astounding influence on the formation of organisms than the biochemical processes of alkaline sequences.

    A Sanskrit mantra is a word or a series of words , which produce longitudinal Scalar waves by resonating your Pineal gland and your DNA.

    Only Sanskrit mantras reprogramme your DNA--it can be done by other languages .Mantras must begin and end with OM . Mantra chanting must be done with intent, and a sense of gratitude to make it more powerful.

    The Phantom DNA effect -- the energy field of a DNA sample remains detectable by laser light even when the physical sample is removed. Russian scientists irradiated DNA samples with laser light. On screen a typical wave pattern was formed. When they removed the DNA sample, the wave pattern did not disappear, it remained.

    In Wave Genetics, the junk DNA functions at a rich infrastructure level of super codes and wave communication, realized in material form as crystalline structures–dynamic gene-holograms in liquid crystals of the chromosome continuum. What this model suggests is that the human gene is part of larger holograms (multiverse) of wave information reality.

    Hyper-communication, in the form of remote sensing, remote healing and telepathy, is a part of the human protocol.

    My wife is a Reiki super-grandmaster--I know the effects of scalar waves which travel faster than light, which cannot be shielded by Faraday cages. The human DNA can produce longitudinal scalar waves.

    Unlike ancient maharishis who had 12 strand NIL junk DNA--we now have 2 strand 97% junk DNA.

    Only 3% of our DNA is wrapped up in the spiraling double helix strand.

    After Dec 21st 2012, man has the opportunity to evolve himself and convert his 2 strand DNA ( 97% junk ) to 12 strand NIL junk due to torsion waves from cosmos.

    when a QUEEN bee/ ant is separated from the colonu , work still continues-business as usual--but the moment you kill the queen, all work goes PHUTTT in a second.

    Universe has no restrictions. We create the boundaries based on our beliefs. These boundaries limit our spiritual growth / inner development which affect our DNA and vice-versa.

    GOOGLE-

    DNA   NASA 

    what do you see on page 1 as item 1- among 10 million posts ?

    why?

    the world is waking up !!

    capt ajit vadakayil
    ..





1.32— tatpratishedhartham ekatattvabhyasah

Adherence to single-minded effort prevents these impediments


To remove the thirteen obstructions and thwart their reappearance, several specific methods have been distinguished.  But absolute surrender to God is beyond the abilities of most ordinary men and women, who are still entangled in pleasure and pain, joy and sorrow, success and failure. Meditation undoubtedly helps to minimise the mental agitations of such people. But in order to conquer all the obstacles to Self-Realisation, all the eight stages of yoga must be followed. Only when body, mind and intelligence are fully sanctified is it possible to submit whole-heartedly to God, without awaiting any return. This is a surrender of the highest order, beyond the capacity of the average individual.   In brief the eight limbs, or steps to yoga, are as follows: Yama :  Universal morality, Niyama :  Personal observances, Asanas :  Body postures, Pranayama :  Breathing exercises, and control of prana, Pratyahara :  Control of the senses, Dharana :  Concentration and cultivating inner perceptual awareness, Dhyana :  Devotion, Meditation on the Divine, Samadhi :  Union with the Divine. These eight steps of yoga indicate a logical pathway that leads to the attainment of physical, ethical, emotional, and psycho-spiritual health. Yoga does not seek to change the individual; rather, it allows the natural state of total health and integration in each of us to become a reality.


  
1.33— maitreekarunamuditopekshanan sukhaduhkhapunyapunyavishayanan bhavanatashchittaprasadanam

By cultivating friendliness towards happiness and compassion towards misery, gladness towards virtue and indifference towards vice, the mind becomes pure.



Citta viksepa is a current of distressed thoughts running like a river. In citta prasadana, graceful diffusion, the turbulent flow is dammed up and consciousness imbues serenely like a lake.  If the citta is caught in the mesh of the senses, and the sadhaka fails to cultivate friendliness, compassion, delight and equanimity, sorrow and unhappiness develops within his heart. This sutra asks one to be rejoiced with the happiness, to be empathetic to the sorrowful, friendly to the virtuous, and unsympathetic to those who continue to live in vice, despite endeavours to change them. This mental adjustment ramps up social as well as individual health. In addition to cultivating these qualities, one should follow the social virtues oiyama  for the well-being of society as a whole. This approach to life keeps the mind of the sadhaka tranquil and pure. These attitudes of the mind towards the different subjects that come before it will make the mind peaceful. Each time we suppress hatred, or a feeling of anger, it is so much good energy stored up in our favour; that piece of energy will be converting into the higher powers.



1.34— prachchhardanavidharanabhyan va prannasya

Optionally, mental equanimity may be gained by the even expulsion and retention of energy.

  

 Prana is not exactly breath. It is the name for the energy that is in the universe. Whatever you see in the universe, whatever moves or works, or has life, is a manifestation of this Prana.   Throwing out and restraining the Prana is what is called Pranayama.  He means that you simply throw the air out, and draw it in, and hold it for some time, (pranayama ) the mind will become  calmer.  The vitality of the breath is the Prana. By this process of breathing we can control all the various motions in the body, and the various nerve currents that are running through the body. Pranayama— where you exhale twice as long as inhale— it is more about dumping old experiences rather than mere oxygenation of blood and producing Nitric oxide by MMMMMM. Breathe in the new , breathe out the old. Pranayama—inhale and exhale with awareness— long exhales with the sound of mmmm. Humming boosts level of nitric oxide—this in turn ups the oxygen intake by 98%, the biggest secret . Ordinary breath is a mere 4%. It is amazing Nitric oxide was discovered by Indian yogis 11000 years ago.  For re-inventing this a Nobel prize was given 2 decades ago. Nitric oxide is necessary for- 1. Destruction of viruses, parasitic organisms, and malignant cells in the airways and lungs by inactivating their respiratory chain enzymes. 2. Regulation of binding - release of O2 to hemoglobin. 3. Vasodilation of arteries and arterioles (regulation of blood flow or perfusion of tissues). 4. Inhibitory effects of inflammation in blood vessels. 5. Hormonal effects. Nitric oxide influences secretion of hormones from several glands (adrenaline, pancreatic enzymes, and gonadotropin-releasing hormone) 6. Neurotransmission. Memory, sleeping, learning, feeling pain, and many other processes are possible only with NO present (for transmission of neuronal signals). Obviously, during mouth breathing it is not possible to utilize one's own nitric oxide which is produced in the sinuses.When there is lack of oxygen in your blood , you living to a small percentage of your potential. The power of breathing lies in its relationship with your energy source. The mind is intimately connected to your breathing. Deep breathing triggers the lymph, your body’s sewage system which will give your cells more efficiency. It keeps the blood fully oxygenated. Breathe in the ration 1/4/2. The physical aspect of lack of oxygen in the body is not as important as the mental and spiritual aspect. Stress, fear and anxiety causes muscles to contract and blood vessels to constrict. When blood cannot be transported freely through the body to provide oxygen, and antibodies and to carry away and dispose toxic wastes, illness sets in. Mind is non material , but it works in partnership with communicator molecules. With every thought mind moves atoms of hydrogen, carbon , oxygen and other particles in the brain . Knowing the connection between breath and consciousness, the ancient yogis devised PRANAYAMA to stabilise energy and consciousness. All that vibrates in this universe is the cosmic personality and prime mover Prana, potent in all living beings and non-living beings --- heat, light, gravity, magnetism, vigor , power , vitality,life, spirit. When a man is contented and happy , he has more Prana inside him. Anxiety vanishes entirely when you are one with the rest of the universe. When your mind is disturbed the fundamental energy Prana leaks . Pranayama just reverses the process. Yoga says that longevity depends on slow diaphragmic breathing. Fluctuations of mind are controlled and hence Pranayama prepares you for meditation.



1.35— vishayavati va pravrittirutpanna manasah sthitinibandhini

Or activity of the higher senses causes mental steadiness.



One may equally attain an exhilarated state of consciousness by becoming entirely engulfed, with dedication and devotion, in an object of interest.  The deity in a temple is just a tool. The practice of contemplating upon an object is the basis of mental stability. Total absorption in the object brings about direct perception of its essence. This sutra demonstrates how to develop awareness and sensitivity in intelligence.  If a man whose mind is disturbed wants to take up Dharana  practices of Yoga, yet doubts the truth of them, he will have his doubts set at rest, when, after a little practice, these things come to him. Dharaṇa may be translated as "holding steady", "concentration" or "single focus". The prior limb Pratyahara involves withdrawing the senses from external phenomena. Dharaṇa builds further upon this by refining it further to ekagrata or ekagra chitta, that is single-pointed concentration and focus, which is in this context cognate with Samatha.  Dharaṇa is the initial step of deep concentrative meditation, where the object being focused upon is held in the mind without consciousness wavering from it. As the seer becomes more advanced, dwelling in the subsequent stage of Dhyāna, consciousness of the act of meditation disappears, and only the consciousness of being/existing and the object of concentration register (in the mind). In the final stage of Samādhi, the ego-mind also dissolves, and the seer becomes one with the object. Generally, the object of concentration is God, or the Self, which is seen as an expression of God. Having controlled the Prana through Pranayama and the Indriyas through Pratyahara, you should try to fix the mind on something. In Dharana you will have only one Vritti or wave in the mind-lake. The mind assumes the form of only one object. All other operations of the mind are suspended or stopped. Dharana can be done only if you are free from the distractions of mind. Concentration without purity is of no use. There are some occultists who have concentration. But they do not have good character. This is the reason why they do not make any progress in the spiritual path. Ethical perfection is of paramount importance. The mind can be fixed easily on any pleasing object-the reason why we have a choice of ishta devata.


1.36- - vishoka va jyotishmati

Or the state of sorrowless Light.


Here, the concentration is on the innermost nucleus of the heart, where alone the sorrowless, effulgent light luminescences. That is the seat of the soul. The mind is guided in such a way that it becomes absorbed, and imbues towards its source. Movements in the form of thoughts in the mind are the waves, and citta, or the seat of consciousness, is the ocean. The sadhaka must learn to keep the citta motionless and thoughtfully silent, without creating waves of thought. This effort of stilling and silencing the citta brings forth the sorrow less effulgent light of the soul.  The last stage of meditation  is the abandoning of any sense of satisfaction, pain, or serenity because any inclination to a good or bad state of mind has disappeared. The meditator thus enters a state of supreme purity, indifference to everything, and pure consciousness.  Meditation abstracts the self from conscious thought, and frees the mind from feelings that cause stress and suffering.   It fosters creative intelligence, raise consciousness, and enables fuller use to be made of mental potential. During meditation thinking is separated from perceiving, so that the individual can stand apart from the emotional self.  Mysticism provides an escape from a life of uninspired existence. It magnifies man and gives him a destiny to fulfill.



1.37- - vitaragavishayan va chittam

Or the mind taking as an object of concentration those sages who are freed of compulsion.

If the sadhaka ponders on the serene, pure state of such divine souls and follows their practices, he earns confidence, achieves firmness and develops a desireless state of mind. Similarly, one can also contemplate each stage of an asana or each movement of breath in order to bring the citta to a state of desirelessness. If consciousness is kept free from desire, it becomes chaste. Mere withdrawal from the world does not in itself achieve this aim. The body of the “realized man” or Jivan Mukt  like Adi Shankaracharya continues to exist until his karmas and prarabdhas ( greater responsibility ) has worked itself out,  and then his mortal coil falls away on his own free will , and he attains Moksha.  A Jivanmukt saint who has burnt his  EGO is NOT cremated in Hinduism. He is buried in a sitting meditative pose. You cannot be deemed a Jivanmukta unless you have the noble qualities for it. Such people have sterling virtues like conscience, lack of ego,  gratitude , lack of desires- selfishness- greed- jealousy- anger- and fear, unlimited compassion,  respect for universal laws,  raised consciousness and humility. He who is the same in honour and disgrace and the same to friends and foes, who has given up all undertakings, he is said to having gone beyond all modes. (Bhagavat Gita 14, 22-25.). A Jivanmukta has reached the imperishable Turiya state.  It means  “consciousness minus thinking” . It represents supreme consciousness free from material influence . . In Turiya there is the absolute awareness. It is the experience of ultimate reality and truth.  In Turiya, the self does not think, feel, or do, but rather observes thought, emotion, and action capable of truly understanding the totality of the universe. Turiya has no limits and no endpoint. It is infinitely transcendent, which means its potential is forever expanding.  You are now a unique individual and you are a vital part of a larger universal life force that transcends everything on earth.. Reality and truth become more clearly defined, allowing you to perceive that which lies above, below, and beyond the human experience. This utterly quiet, peaceful and blissful state is the ultimate aim of all spiritual activity this highest state is not affected by Maya The Waker, The Dreamer, The Deep Sleeper and The Observer. You experience detachment and joy .  Turiya Consciousness  is the ultimate goal of spirituality for here you know what freedom is all about. Turiya is regarded as synonymous with videhamukti, liberation without a body A saint is a very ordinary guy.. A sage is the extraordinary being. A sage does not dream, because he has no polarity. He’s just a witness. In Hindusim your physical body is just like clothes or a snake skin.  On death you just change your body to another one.
A Jivanmukta is a sage who is liberated from bondage even while living with a body.  . He has delight in the Self, he sports in the Self, he has company with the Self, he has bliss in the Self.  He is autonomous. He has unlimited freedom. The Jivanmukta does not feel the necessity for abiding by what brings pleasure to the physical body. The palm of the hand is his bowl, the earth is his bed, the sky is his clothing.  He has reached the climax of perfection and the whole universe is a part of his body. The forces of the universe are his friends, not his enemies . The sage does not care for public criticism. He keeps a cool mind even when he is abused or assaulted.


1.38- - svapnanidrajnanalambanan va

Or depending on the knowledge of dreams and sleep.


Four stages of consciousness : consciousness plus thinking is waking,  consciousness minus thinking is turiya, unconsciousness plus thinking is dreaming,  unconsciousness minus thinking is sleep.  The semi-circle of OM symbolizes Maya and separates the dot from the other three curves. It is the illusion of Maya that prevents us from the realization of this highest state of bliss. The semi-circle is open at the top and does not touch the dot. This means that this highest state is not affected by Maya. Maya only affects the manifested phenomenon. In Turiya thoughts subside and one becomes increasingly more awake; the mind settles down and consciousness itself becomes primary.  Mediators describe this as pure consciousness or unbounded awareness. One sees the entire world and all things within it as part of oneself, and oneself part of all. Turiya  is a state of transcendence, the result of arduous meditation.  There can be no consciousness without passage through intense pain. The Upanishads equates this experience with enlightenment.  We ordinary people lack contact with our fourth state of consciousness, and so we fail to live up to our potential as human beings. This utterly quiet, peaceful and blissful state is the ultimate aim of all spiritual activity this highest state is not affected by Maya The Waker, The Dreamer, The Deep Sleeper and The Observer.  Turiya is freedom from the limitation of the other states . You experience detachment and joy .  Turiya Consciousness  is the ultimate goal of spirituality for here you know what freedom is all about.



1.39- - yathabhimatadhyanad va

Or, by meditating on any desired object conducive to steadiness of consciousness.

The purpose of meditation in modern times is to destress, to stop the destructive mind chatter, for some time in a day,--  to STILL the mind. he brain must not be allowed to pump in destructive F&F ( fight & flight ) chemicals into your body, which will shorten your life. The reason why people remain mired in negativity is because of the beliefs they have inherited over time. Beliefs are subconscious . We can use our conscious mind to observe ,to introspect and dip into the subconscious where our beliefs are embedded , in order to eliminate it. You can meditate, to rewrite these negative programmes that cause you misery. During meditation thinking is separated from perceiving, so that the individual can stand apart from the emotional self. Indians use meditation to purify the mind and gain insight. There is self observation and introspection ( which animals cannot do ). This does not mean any wicked subject, but anything good that you like, any place that you like best, any scenery that you like best, any idea that you like best, anything that will concentrate the mind. The ultimate method is to choose an object beneficial to meditation, not one which is externally pleasing, but auspicious and spiritually enriching. By practising this simple method of one-pointed attention, the sadhaka gradually develops the act of contemplation.. Patanjali advises followers to trace the seed of that core, the living spirit that interpenetrates everything from the most infinitesimal particle to the infinitely greatest. This is the most difficult subject to meditate upon.

1.40- - paramanu paramamahattvantosya vashikarah

The mastery of one in Union extends from the finest atomic particle to the greatest infinity.


The level of consciousness in you depends on the amount of energy it is capable of storing. By projecting your intention and changing your brain vibration > 40 Hz Gamma through altering the state of your consciousness , you can develop psychic powers. When you use psychic power you tap into the level of the universe, where individuality does not exist. At this level each of us is a part of a universal and cosmic consciousness where we are connected as though held together by invisible threads. This interconnectedness means that every thing we do or think affects everything and everyone else. All atoms in the entire universe are capable of mind reading and communicating with other atoms. There is a consciousness in every molecule of matter. Most people never raise their consciousness much above that of the animal and the spark of divinity within them remains dormant the whole of their lives. Animals express consciousness through instinct. Self awareness or reflective thought is the difference between animals and humans. Our consciousness is expressed energetically through coherence and interactions of electromagnetic fields. Consciousness is a form of electromagnetic energy which with focused thought and intent can achieve extraordinary things.The sadhaka is not only liberated from all disturbances of the mind; he has also repressed his consciousness and mastered his passions. His consciousness reaches a height of transparency in which it develops the power of interpenetrating objects from the minutest atoms to the impressive cosmos. This sutra describes how the ordinary mind is metamorphosed into a super-mind, is able to imbue the limitless regions of space, and the deepest regions within. The mind, by this practice, easily contemplates the most minute thing, as well as the biggest thing. 

1.41— ksheennavritterabhijatasyev manergrahitrigrahannagrahyeshu tatsthatadangjanatasamapattih

When the agitations of the mind are under control, the mind becomes like a transparent crystal and has the power of becoming whatever form is presented- knower, act of knowing, or what is known.

Whenever a yogi meditates he can keep out all other thought; he becomes identified with that on which he mediates; when he meditates he is like a piece of crystal; before flowers the crystal becomes almost identified with flowers. If the flower is red, the crystal looks red, or if the  flower is blue , the crystal looks blue. With refinement, the consciousness becomes exceedingly sensitive, choiceless, untainted and chaste. The perceiver, the instrument of perception and the Perceived object, evidently reflected, are nothing but the seer. Like an object reflected immaculately on a clean mirror, the perceiver, the perceived and the instrument are reflected as one. This transparent reflecting quality of consciousness is termed samapatti, which means assumption of the original form of the seer. Patanjali's description of samapatti emphasises the subtle distinction between yoga, samadhi and samapatti. Yoga is the utilisation of the means to attain samadhi. Samadhi is profound meditation and total absorption. Samapatti is the equilibrised state of mind of the seer who, having attained samadhi, radiates his own pure state. Yoga and samadhi, in other words, can be looked upon as practices; samapatti stands for the state towards which they lead. When all the fluctuations of mind's sattvic, rajasic and tamasic nature reaches a culmination, mind quits to gather and convey information, and cilia is like the placid, clear water of a calm lake. It transforms itself to the level of the seer, and reflects its transparency without refraction. Like a transparent jewel, it becomes at once the knower, the instrument of knowing and the object known. Thus the sadhaka experiences the true state of the soul. Samapatti is enshrined in abhijatamani, which means faultless jewel. Citta is now a faultless jewel. By yogic discipline and contemplation, the sadhaka develops these intuitive qualities of transparency and honesty and realises the faultless quality of consciousness. Through it, he becomes the seer and emanates rays of wisdom through his words, thoughts and actions.



1.42— tatra shabdarthajnanavikalpaih sankeerna savitarka samapattih

At this stage, called savitarka samapatti, the word, meaning and content are blended, and become special knowledge.



Sampathi is similar to Samadhi .  Samāpatti stands for correct (samyag) acquisition (āpatti) of Truth. It is a form of alaukika-pratyakṣa (extraordinary perception) forming thus a legitimate part of the perceptual (pratyakṣa]] instruments of adequate knowledge (pramāṇa). In the Yoga Sutras of Patanjali, samapatti is discussed as the universal form of the Yoga called samprajñāta-samadhi, or savikalpa samadhi, followed by asamprajñāta-samadhi, or nirvikalpa samadhi.   It has as its prerequisite the annihilation of all (non-sattvic) modifications (vṛtti) of consciousness (citta). Savitarka meditation relates to concentration on a gross object while still accompanied with other activities of the mind. It involves the co-mingling of three things: the object itself, the word or name we give to the object, and knowledge related to the object. There are many different gross objects on which one might meditate at the Savitarka level. In the refined state of consciousness, words and their meanings are simultaneously and tunefully coalesced with understanding, so that consciousness becomes enwrapped in a new kind of knowledge. This is savitarka samapatti.   When you contemplate the whole universe as if it is in space and time, it is the lowest samadhi – savitarka. When you are struggling to obviate the interference of space and time and attack the universe as it is in itself, without any kind of association of space and time, that is nirvitarka samadhi, a higher state. Sound here means vibration; meaning, the nerve currents which conduct it; and knowledge, reaction. All the various meditations we have had so far, Patanjali calls Savitarka (meditations with reasoning). Later on he will give us higher and higher Dhyanas. In these that are called “with reasoning,” we keep the duality of subject and object, which results from the mixture of word, meaning, and knowledge. There is first the external vibration, the word; this, carried inward by the sense currents, is the meaning. After that there comes areactionary wave in the Chitta, which is knowledge, but the mixture of these three makeup what we call knowledge. In all the meditations up to this we get this mixture as object of meditation. The next Samadhi is higher.



1.43— smritiparishuddhau svaroopashoonyevarthamatranirbhasa nirvitarka

In nirvitarka samapatti, the difference between memory and intellectual illumination is disclosed; memory is cleansed and consciousness shines without reflection.



Nirvitarka is concentration on a gross object in which there are no longer any extraneous gross level activities in the mind because of the memory having been purified.  Notice that with Savitarka, there was not only meditation on the object, but also there were the other thought streams in the mind, though these were not distracting due to vairagya (non-attachment). Here, in Nirvitarka, these thought patterns have subsided.  When memory is completely purged and purified, mind too is purified. Both discontinue to function as distinct entities; a no-mind state is experienced, and consciousness alone expresses itself, shining untarnished without reflection of external objects.  Memory is the recapitulation of past thoughts and experiences. It is the storehouse of past impressions. Its knowledge is reflected knowledge. The sadhaka should be aware that memory has incredible impact on intelligence. By tenacity in yoga practices and persistent self-discipline, new experiences come to light. These new experiences, liberated from the memories of the past, are fresh, direct and subjective; they wipe out what is remembered. Then memory ceases to function as a separate entity. It either unites with consciousness or takes a secondary position, giving prevalence to new experiences and bringing precision in intelligence. For an average person memory is a past mind. For the enlightened man, memory is a present mind. As memory is purged, intelligence becomes illuminative and moves closer to the seer, losing its identity.Even for the unripened mind, there is a right and a wrong use of memory. It is not for recapitulating bliss, but for establishing a support of experience as a source for further accurate action and perception. In asana, for instance, one commences with trial and error. The fruits of these experiments are graded by the discriminating intelligence and stored in the memory. As one progresses, trial and error decreases, and correct perception increases. So memory provides foresight against error. Awareness, with discrimination and memory, breaks down bad habits, which are reiterated actions based on incorrect perception, and replaces them with their opposite. In this process the brain must be ingenious, not mechanical. The mechanical brain questions only the external occurrences, bringing objective knowledge. The creative brain questions the inner and outer, bringing subjective and spiritual knowledge. When awareness is associated with intelligence, honesty comes into being; when brain and body proceed in harmony, integrity prevails. In all this lengthy process of tapas, memory supports the building-up process. When memory works perfectly, it becomes one with the intelligence. When the sound comes, the senses vibrate, and the wave rises in reaction; they follow so closely upon one another that there is no discerning one from the other; when this meditation has been practiced for a long time, memory, the receptacle of all impressions, becomes purified, and wwe are able clearly to distinguish them from one another. This is called “Nirvitarka,” concentration without reasoning.


1.44— etayaiva savichara nirvichara cha sookshmavishaya vyakhyata

The contemplation of subtle aspects is similarly explained as deliberate (savicara samapatti) or non-deliberate (nirvicara samapatti).


Beyond both Savitarka and Nirvitarka is Savichara. With Savichara, the gross thoughts (Vitarkas) have subsided, but there are still subtle thought patterns, which are called Vichara. Savitarka Samapatti and Savichara Samapatti are similar processes, though one is on gross thoughts, while the other relates to subtle thoughts. Nirvichara is concentration in which there are no longer any extraneous gross or subtle activities in the mind. This purity of mind comes through the processes of meditation and non-attachment. In Nirvichara Samapatti, the engrossed mind completely takes on the coloring of the subtle object of meditation, much like a pure crystal will take on the coloring of whatever color it is near. With increasing mastery of Nirvichara, the eternal Self begins to shine for the aspirant.  Transformation of the consciousness by contemplation on subtle objects like the ego (ahamkara), intelligence (buddhi) or the equivalent of the elements (sound, touch, sight, taste and smell), or the qualities of luminosity, vibrancy and dormancy of nature, conditioned by space, time and causation, is savicara samapatti. Without these reflections it becomes nirvicara samapatti.  In nirvicara samapatti, the sadhaka experiences a state without verbal deliberation. All the subtle objects reflected in savicara are eliminated. He is free from memory, free from past experiences, devoid of all past impressions. This new state of contemplation is without cause and effect, place or time. The inexpressible states of pure bliss (ananda) and pure self (sasmita) rise to the surface and are experienced by the sadhaka.



1.45— sookshmavishayatvan chalinggaparyavasanam

The subtlest level of nature (prakrti) is consciousness. When consciousness dissolves in nature, it loses all marks and becomes pure.


The gross objects are only the elements, and everything manufactured out of them. The fine objects begin with the Tanmatras or fine particles. The organs, the mind, egoism, the mind-stuff (the cause of all manifestion) the equilibrium state of Sattva, Rajas and Tamas materials—called Pradhana (chief), Prakrti (nature), or Avyakta (unmanifest), are all included within the category of fine objects. The Purusa (the  Soul) alone is excepted from this definition. By exploring the understated particles of nature, the consciousness attains its destination. It is a state of complete termination of the fluctuations of the mind. That is the subtle, infinitesimal intelligence (mahat) of nature (prakrti). Prakrti and pradhana original or natural form of anything, nature; alihga, un-manifested form . . .. .Prakrti Pradhana primary or original matter, the first evolved source of the material world, that which is placed or set before, chief or principal thing (these are all liable to change, while the soul (purusa) is changeless) .   The subtlest of the infinitesimal principles of nature is the cosmic intelligence (mahat), which in an individual is transformed as the 'I' in a forceful, minute form, called asmita or the small self. Though the Self does not change, the small self brings about changes in a human being due to the influence of nature's qualities. The body is made up of the particles oi prakrti - from its outermost sheath, the body, to its innermost core, the deep Self. When the individual self, the 'I' is quieted down by yogic practices, prakrti has reached its end and unites with the Self. This is subjective experience, or subjective knowledge.  The sadhaka attains purity in buddki and ahamkara, the infinitesimal source or summit of nature, mula-prakrti. Here, the sadhaka has reached the juncture of Self-Realisation.



1.46— ta eva sabijah samadhih

These constitute seeded contemplations.



The states of samadhi described in the previous sutras are dependent on a support or seed, and are termed sabija.   The savitarka, nirvitarka, savicara, nirvicara, sananda and sasmita satnadhis are known as sabija (seeded or with seed) satnadhis.   Beyond both Savitarka and Nirvitarka is Savichara. With Savichara, the gross thoughts (Vitarkas) have subsided, but there are still subtle thought patterns, which are called Vichara. Savitarka Samapatti and Savichara Samapatti are similar processes, though one is on gross thoughts, while the other relates to subtle thoughts. Nirvichara is concentration in which there are no longer any extraneous gross or subtle activities in the mind. This purity of mind comes through the processes of meditation and non-attachment. In Nirvichara Samapatti, the engrossed mind completely takes on the coloring of the subtle object of meditation, much like a pure crystal will take on the coloring of whatever color it is near. With increasing mastery of Nirvichara, the eternal Self begins to shine for the aspirant. All the states of samapatti described in 1.17-19 and 1.42-45 are seeded satnadhis.  All these satnadhis are dependent on an object which includes the intelligence (buddhi) and the I principle (asmita). Their seed is the nucleus of the being, the only seedless seat in individuals. Asmita is a very fine level of individuality or ego, meaning the way thought impressions become colored by I-am-ness, so as to mistakenly think that this thought pattern or memory is related to me. Meditation on Asmita gradually reveals the individuality, standing alone, underneath all of the attractions, aversions, and fears. It is remarkable to note that the six samapattis mentioned so far belong to the functions of the brain. The source of analysis (savitarka) or absence of analysis (nirvitarka) is the frontal brain. For investigation and examination (savicara) or absence of them (nirvicara), the source is the back brain. The source of joy (ananda) is the base of the brain, and of individuality (asmita), the top of the brain.  Through the disciplines of yoga, the sadhaka transforms his attention from the gross to the subtle. When he reaches the summit of nature, the brain being a part of nature, he attains precision in controlling the modes of consciousness. He is able to stop all functions of the brain, deliberate and non-deliberate, at will. That is why it is termed samadhi with seed.  Whatever is dependent on nature for contemplation is seeded samapatti. The contemplation of the seer, who is the source of all seeds, is without support. Though both seer and nature are eternal, nature is changeable while the seer remains the same, irreversible, not dependent upon any support except his own self. That is why contemplation of the seer is seedless or supportless (mrbija) samadhi.  Similar to the petals of a lotus, which blossom forth as the sun rises, and closes as it sets, the petals of the brain retreat from the fringe to its source, its stem, or bud, and all its functions stop. This is commonly called asamprajnata samadhi. It is the threshold between sabija and mrbija samadhi. If the sadhaka remains on the threshold, he barely subdues the elements. If he falls back, he is caught in pleasures and pains. If he crosses over, he achieves freedom and beatitude.





1.47— nirvicharavaisharadye adhyatmaprasadah

From proficiency in nirvicara samapatti comes transparency. Sattva or luminosity flows undisturbed, kindling the spiritual light of the self.


In the state of nirvichara where deliberate argumentation, analysis, etc. cease, the logical function of the mind comes to an end and there is no deduction or induction process any longer – there is only direct visualisation. Here, the peace of the Self manifests itself. Where does it manifest itself? In the luminous condition attained through the meditation known as nirvichara. Prasadah is peace, serenity, tranquillity – complete self-absorption free from all distractions and rajasic agitation. The concentration “without reasoning” being purified, the Chitta becomes firmly fixed. When intelligence and consciousness, the substance of man, remains non-reflective, profound and unconditioned, the vehicles of the soul - the anatomical body, the organs of action, the senses of perception, the mind, intelligence and consciousness - are illuminated. Knowledge and understanding of the real state of the soul manifest in luminosity. Present is the reality. The past is finished, and the future doesn’t exist. When the Kundalini rises she elongates those thoughts and establishes in the center where there is complete thoughtless awareness. And spiritually you grow in that thoughtless awareness which  we call as Nirvichara Samadhi.



1.48— rtanbhara tatr prajna

Therein is the faculty of supreme wisdom.



1.49— shrutanumanaprajnabhyam anyavishayaa vishesharthatvat

The wisdom obtained in the higher states of consciousness is different from that obtained by inference and testimony as it refers to particulars.


Truth-bearing knowledge is first-hand, intuitive knowledge.  This wisdom is acquired by the means of insight. It is an exceptional, direct knowledge arising from the soul, not from the perception of the senses or from the ordinary understanding. Hence, it has an unusual property of its own. The knowledge that springs from one's inner self is intuitive knowledge. It is also known as 'listening to the inner voice'.  The sadhaka may be judged to be of a mature and cultured mind; his perceptions have an independent soundness requiring no verification from other sources. An ordinary man possesses free will in the sense that he experiences choice and must find his way by discrimination. The enlightened sadhaka, having left duality behind him, experiences only his own will, which surpasses the vacillations of choice. This is the intelligence of sattva in sattva. The idea is that we have to get our knowledge of ordinary objects by direct perception, and by inference therefrom, and from testimony of people who are competent. By “people who are competent,” the Yogis always mean the Rishis, or the Seers of the thoughts recorded in the Scriptures—the Vedas. According to them, the only proof of the Scriptures is that they were the testimony of competent persons, yet they say the Scriptures cannot take us to realisation. We can read all the Vedas, and yet will not realise anything, but when we practise their teachings, then we attain to that state which realises what the Scriptures say, which penetrates where reason cannot go, and where the testimony of others cannot avail. This is what is meant by this aphorism, that realization is real religion, and all the rest is only preparation—hearing lectures, or reading books, or reasoning, is merely preparing the ground; it is not religion. Intellectual assent, and intellectual dissent are not religion. The central idea of the Yogis is that just as we come in direct contact with the objects of the senses, so religion can be directly perceived in a far more intense sense. The truths of religion, as God and Soul, cannot be perceived by the external senses. I cannot see God with my eyes, nor can I touch Him with my hands, and we also know that neither can we reason beyond the senses. The whole scope of realisation, is beyond Newtonic sense perception. The Yogis say that man can go beyond his direct sense perception, and beyond his reason also. Man has in him the faculty, the power, of transcending his intellect even, and that power is in every being, every creature. By the practice of Yoga that power is aroused, and then man transcends the ordinary limits of reason, and directly perceives things which are beyond all reason. In Indian yoga, intuition is the single greatest tool .Intuition is soul guidance or the inner voice. Intuition helps you stay in the present, like what is advocated in the Bhagavat Gita. It has little to do with predicting the future. All the human senses are channels for intuition and every cell can be an antenna to receive information. Intuition is a gift of crisis--- It tells you the right thing to do when you don't have time to figure it all out. Intuits are able to see possibilities and alternatives that aren’t immediately apparent. Your inner knowing comes from first your instincts, second your intellect, and third from your intuition. Intuition is not pseudo-science . It is an essential psychological function like thinking, feeling and sensing. The divining power of intuition comes from our inner self. It arises from very rapid processing of bits of information that are stored in our subconscious. Intuition thinks in terms of metaphor, feelings, pictures, and the spatial whole and doesn't fit neatly into the cause-and-effect model. Your intuition will not force you to do things that are truly wrong for yourself or other people in contradiction with the laws of the universe. Intuition is listening to the inner voice or heeding the promptings from within. Intuition is a ability to cut through the thickness of surface reality.  Your sub-conscious which operates a dozen times faster than your conscious mind has picked up on signals that your conscious mind has not yet processed. We function through partial information, and intuition gives us an overview, a whole sense of things. The divining power of intuition comes from our inner self-- very rapid processing of bits of information that are stored in our subconscious. We cannot command our gut feeling to use it at will. It just surfaces spontaneously when certain circumstances are present. Intuitive insights suddenly appear as ideas or feelings. Intuitive decisions are NOT guesswork . Intuition has an important role to play in decision making . Intuition is not limited to opinions but can encompass the ability to know valid solutions to problems. Intuition usually shows up in the areas where you have passion and talent. By logic that we prove, by intuition we discover. Intuition is a sudden and inexplicable knowing. It lies at the roots of spontaneity, humor, creativity, inspiration, and even genius. Intuition has its own unique language for communicating with you through touch, sight, taste, sound, and smell. As you pay attention to your senses, you’ll begin to understand the “vocabulary” of your intuition. Mental static and EGO can get in the way of tapping into intuition. Intuition bubbles up from within and can be overwhelmed by old mental or emotional "tapes" . Intuition gone wild becomes “jumping to conclusions”. By going too far out on a limb , you risk misinterpreting the situation and start harming others. Intuition should not be overused. So what exactly is intuition? It is the messages from your unconscious mind making contact with your consciousness. . The uncanny ability to detect patterns in the world around us, and to extrapolate larger truths . Use it always, never ignore it. By listening to what our heart and soul tells us to do - and then doing it - we can take ourselves anywhere we have ever dreamed of going. Your consciousness only uses a tiny proportion of your brainpower and your intuition accesses the residual power and communicates to your consciousness the bank of wisdom and knowledge it has available. This is done subtly through thoughts, feelings, sensations, images, sounds or any combination of them. Just as animals have a natural survival instinct so humans are born with the natural ability to be intuitive; your human instinct. Intuitive insights motivate us to grow closer to the creative source, thereby igniting our own creative spark and expression, which is the essence of our true self. When you feel excited about something, that's a hint about what to pursue. Decisions are made in the mind—choices are made in the gut.  Choices come from your essence and attunement to your higher self.




1.50— tajjah sanskaro nyasanskarapratibandhi

A new life begins with this truth-bearing light. Previous impressions are left behind and new ones are prevented.

When the power of the intellect springs from passionate insight, that insight neutralises all previous residues of action, movement and impression. Vritti (whirlpool, thought-wave) arises in the mind-ocean. It operates for sometime. Then it sinks below the threshold of normal consciousness. From the surface of the conscious mind wherein it was uppermost for some time, it sinks down deep into the region of the subconscious mind (Chitta). There, it continues to be a subliminal action and becomes a Samskara (impression). A conscious action-whether cognitive, affective or conative-assumes a potential and hidden (Sukshma and Avyakta) form just below the threshold of consciousness. This is termed a Samskara. The Samskaras (impressions) are embedded in the subconscious mind or Chitta. The past is preserved even to the minutest detail. Even a bit is never lost. When the fine Samskaras come up to the surface of the conscious mind back again as a big wave, when the past Vritti comes back to the surface of the conscious mind again by recollection, it is called memory or Smriti. No memory is possible without the help of Samskara. A Samskara of an experience is formed or developed in the Chitta at the very moment that the mind is experiencing something. There is no gap between the present experience and the formation of a Samskara in the subconscious mind. A specific experience leaves a specific Samskara. The memory of this specific experience springs from that particular Samskara only, which was formed out of that particular experience. New samskaras may continue to come forth due to the vacillations of the mind, and this may obstruct real knowledge. These mental impressions must be supervened upon by the power of discrimination, and then all doubts fade away. When doubts are cleared, the sadhaka has to dispose off even this discriminative knowledge. The new illuminating wisdom is free from doubts and discriminations; it blazes forth, a shimmering beacon of knowledge. The only way of attaining to that super-consciousness is by concentration, and we have also seen that what hinder the mind from concentration are the past Samskaras, impressions. Brain is not capable of distinguishing between reality and memory—the same neurons are sparked when we see something as when we merely remember it. Brain cannot distinguish between an image of experience and one of vivid imagination. When a person is in coma , anastesia, narco serum, shock, seizure or sleeping—the subconscious minds are wide open. Anything that will be said in their presence will be accepted by the spirit which will begin carrying it out.  Any passing comment or trivial statements can have a devastating effect on our subconscious mind because it is not argumentative or analytical. It accepts all statements directly on the face value. Even prayers and beliefs are positive signals which we give to our subconscious mind as something acceptable and true. The subconscious mind cannot tell the difference between a real experience and one that you vividly imagine. You can fool it or condition it. The subconscious mind does not think—it is only a store house of our experience. It has no sense of time. It cannot differentiate between positive and negative input. It cannot tell the difference between real and imagines experience. The conscious mind can be engaged 100% in talking or deep thinking while the subconscious keeps the car on the road. The conscious and subconscious minds are connected through a filter. So we cant read the contents of our subconscious mind. Subconscious, mental activities within an individual proceed without his awareness. Dreams and slips of the tongue are concealed examples of unconscious content too threatening to be confronted directly.  When the situation demands we are able to use the subconscious memory to the full extent—but only in relation to the specific problem. The conscious mind has limited memory. The subconscious mind has unlimited memory. Subconscious mind never sleeps even in a coma. the Subconscious has a tendency to accept what it imagines as real.  Every experience we have ever had is impressed somewhere in the electrochemical cells in our brain. The brain records every thing—every thing senses by our 5 senses—and it is imprinted in the brain cells for ever. Whenever something reactivates those cells we get a mental picture duplicating the original experience. The picture in our mind has an impact on every cell in our bodies. Thinking is not an action of the mind , but an action of our entire body. Tell your subconscious what you want repeatedly and it will produce it. You can call this visualization or intention.  The subconscious has a perfect memory. Every thing you have experienced using your 5 senses is part of the permanent memory of the subconscious mind, which never sleeps The subconscious mind acts on old beliefs stored over a lifetime. Many of those beliefs you may have accepted without thinking. Or you may have absorbed them when you were too young to exercise choice. Subconscious mind has a memory of 100 trillion images, all our experiences, emotions and feelings are stored as an image or a sound in a digitised manner . Data that cannot be recalled are retained in the subconscious. A person may be unconscious of ever having been locked in a closet as a child, yet under hypnosis he may recall the experience vividly. Negative suggestions with growing children gets rooted in their subconscious mind and is reflected later in their behavior.  During hypnosis –our conscious mind goes into a trance and suggestions are given directly to the subconscious mind, which cannot argue but accepts the suggestion at its face value. We do self hypnosis unknowingly several times an a day while doing our day to day activities. This is how our body learns to relax otherwise we would die of stress at a very early age. Any monotonous sequence of events make it boring for the brain and eventually it starts producing a hormone called Serotin which induces a drowsy state of mind.  There are samakaras of past life on the soul which causes phobias in current life.  They can be dissolved by meditation . A child is born with his Samskaras. A child is born with his past experiences transmuted into mental and moral tendencies and powers. By experiences, pleasant and painful, man gathers materials and builds them into mental and moral faculties. The aim of a Sadhaka is to fry out or burn or obliterate all these Samskaras through Nirbija Samadhi. Sadhana consists in wiping out the Samskaras. Jnani is without Samskaras. They are fried out by Jnana. No doubt, the force of the Samskaras remains in the Antahkarana. But they are harmless. They will not bind the Jnani.




1.51— tasyapi nirodhe sarvanirodhannirbijah samadhih

When that new light of wisdom is also relinquished, seedless samadhi dawns.

The sadhaka must learn to hold back even this new impression of truth-bearing light.  When both old and new impressions are dissolved, a state of seedless enlightenment arises, in which all illusions and delusions cease. This is nirbija samadhi - the state of absolute identity with the seer. Even this distinctive knowledge of insight (1.50) has to be checked, curbed and moderated. Then, as  rivers cease to have their individual existence on uniting with the sea, all volitions and impressions of the unconscious, subconscious, conscious and super-conscious mind cease to exist. All these rivers of consciousness unify with the ocean of the seer. Nirbija samadhi is the conquering of the citta where the root mind is one with the seer. As all invading thoughts are brought to an end by practice and detachment, the soul is freed from the pinions of earthly vehicles - the body, senses, mind, intelligence and consciousness. The seer is in the amanaskatva state. When citta is dependent on an object, idea or symbol, the state is called sabija samadhi. In nirbija samadhi, citta dissolves and no deposit of impressions remain. All residual impressions, the thinking faculty and the feelings of 'T' are extinguished without trace and become universal. The soul alone manifests and rages without form, in immaculate clarity. You remember that our goal is to perceive the Soul iself. We cannot perceive the Soul because it has got mingled up with nature, with the mind, with the body. The most ignorant man thinks his body is the Soul. Samskaras cover the Soul. The real nature of the Soul is not perceived until all the waves have subsided; so, first, Patanjali teaches us the meaning of these waves; secondly, the best way to repress them; and thirdly, how to make one wave so strong as to suppress all other waves, fire eating fire as it were. Red Adiar put out large oil rig fires by using the same medium ( not water , it wont work ) --- he produced a second HUGE fire which he could control by remote, it just ate up the smaller oil rig fire-- and then he put it off by remote.   The truths of life are congruent till a laxman rekha--  after that the reverse happens-- When only one wave remains, it will be easy to suppress that also, and when that is gone, this Samadhi of concentration is called seedless; it leaves nothing, and the Soul is manifested just as It is, in Its own glory. Soul cannot be born, It cannot die, It is immortal, indestructible, the Ever-living Essence of intelligence. It is a part of the mother field of brahmAn.



THIS POST IS NOW CONTINUED TO PART 54 , BELOW-





CAPT AJIT VADAKAYIL
..

63 comments:

  1. Navjot Singh Sidhu:

    TOP BRASS OFFICIALS OF A COUNTRY should have their kids educated and live within their country, especially in these hostile times. Education maybe exempted.

    We have top military brass, politicians and all sending their kids living in the Five Eyes and Europe.

    Do they have any personal future stake in India

    If no, then why such high official positions to govern and protect the country

    Their kids live in India only if see themselves getting same posts as if its their Fundamental Right

    ReplyDelete
  2. http://timesofindia.indiatimes.com/india/Govt-bans-foreign-funding-for-69-NGOs-30-of-them-work-for-minorities/articleshow/46461898.cms

    THE EVR PERIYAR - BR AMBEDKAR STUDENTS UNION LEADERS HAVE FOREIGN FUNDING.

    THEY DRESS UP SHABBILY AND THEIR HOMES LOOK LIKE PIG STY HOVELS--BUT THEY HAVE GOOD MONEY , AS CAN BE SEEN BY THE FOOD THEY EAT AND THEIR TRAVEL

    THE WESTERN NATIONS KNOW THAT IN 17 YEARS THEY WILL BE RULED BY BROWN SKINNED INDIA-- WE WILL BE THE PLANETS NO 1 SUPERPOWER

    BEFORE THAT THEY WANT INDIA TO IMPLODE.

    FOREIGN FORCES CONTROL MOST OF THE THE BENAMI MEDIA, COLLEGIUM JUDICIARY AND RAJYA SABHA MPs

    Putin is very clear-- he made a law in Russia that requires non-profit organizations that receive foreign donations and engage in "political activity" to register and declare themselves as foreign agents.

    On Valentine's Day 2013, Putin warned "Any direct or indirect interference in our internal affairs, any form of pressure on Russia is unacceptable."

    A NGO must then submit to extensive audits. Supervisory powers are allowed to intervene and interrupt the internal affairs of the NGO

    The "foreign agents" law on NGOs qualifies as political activity under the "foreign agents" law.

    Putin is NOT a fool-- several prominent international organizations have been targeted, including Amnesty International, Human Rights Watch, and Transparency International.

    As a follow-up to the Foreign agent law, on 23 May 2015, President Putin passed the Undesirable Organizations bill into law citing "national security".

    The law bans non-governmental organizations that it deems undesirable as a "threat to the constitutional order and defense capability, or the security of the Russian state."

    NGOs that do not disband when given notice to do so are now subject to high fines and significant jail time.

    WE DO NOT NEED FOREIGN LARGESSE IN INDIA. THESE ARE DESH DROHIS . .

    China has enacted a law that regulates non-governmental organisations with foreign ties, -- with a set of laws that grants the security apparatus sweeping legal powers

    The NGO law authorises the ministry of public security to establish a list of ‘unwelcome’ organisations banned from operating in China, prohibits illegal programmes or religious activities and requires projects and funding sources to be registered with the ministry.

    China and Russia will NOT allow a foreign funded organisation that hurts its national interest.

    NO WHITE NATION WILL GIVE FREE MONEY TO INDIA . . TO CATCH FISH YOU NEED A BAIT-- THIS MONEY IS JUST A BAIT

    WE HAVE BEEN SLAVES FOR 800 YEARS . THE PUNISHMENT FOR DESH DROHIS IS ZERO.

    NHRC AND COLLEGIUM JUDGES SAVE DESH DROHIS AS SOON AS THE GOVT CATCHES THEM.

    capt ajit vadakayil
    ..

    ReplyDelete
    Replies
    1. Capt Ajit, I am ex ch ERA of Indian Navy and sailed in merchant ships for almost 30 years, 25 years as C/E of both steam and motor ships. I have also taught marine engineering in ARI, Delhi.
      I am sorry to see the above statement and feel hurt. I am now retired from service but assure you that I can teach engineering to any body from other institutes. I have also come across useless engineers who have passed out of MERI. So donot generalize ex artificers of Indian Navy because majority of them are excellent marine engineers. I have saved ships during disasterous condition and severe sea conditions during my tenure as C/E. This is the reason above statement is hurting me so much. I hope you can change your opinion. Thanks

      Delete
    2. Capt Shot sir
      If you have allowed the publication of ex soldier (ex Indian navy guy )than you should answer to him .He is a veteran his comment should not be ignored or discounted

      Delete
    3. AN ERA IS "ENGINE ROOM ARTIFICER " WHICH IS A FITTER

      DO YOU UNDERSTAND THE DIFFERENVE BETWEEN A FITTER AND A GRADUATE ENGINEER , WHO SLOGGED FOR 4 YEARS ?

      DO YOU UNDERSTAND THE DIFFERENCE BETWEEN A WIREMAN AND AN ELECTRICAL GRADUATE ENGINEER ?

      DO YOU UNDERSTAND THE DIFFERENCE BETWEEN A MASON AND A GRADUATE ARCHITECT?



      Delete
  3. http://operationdisclosure.blogspot.my/2016/07/scalar-weapons-12-things-you-should-know.html

    ReplyDelete
  4. Hi Captain,

    Is it really difficult for the government to ban channels and people like ndtv, burka dutt etc?

    ReplyDelete
  5. I'm in no way suggesting our material is directly related, but the falsification of history you are largely focused on can be attributed to the media, at least at present. Our project is an effort to reign in the corrupt media... https://youtu.be/2-O1eOqjtA4

    ReplyDelete
  6. Hi Captain,

    It seems like most of the Muslims disguised as Refugees are actually Jihadis invading Europe with a larger Agenda of Islamizing European continent. Muslims themselves admit in the videos that they will wage Love jihad on kafir women and do Population Jihad and take over Europe slowly but surely.

    ####################

    THE MOST DISTURBING VIDEO ON THE ISLAMIC INVASION OF EUROPE

    Video Link ---> https://www.youtube.com/watch?v=BPKqM-TV2i8

    GERMAN GIRL TALKS ABOUT MUSLIM IMMIGRATION & DESTRUCTION OF HER GERMANY

    Video Link ---> https://www.youtube.com/watch?v=uGfP8CyJAhg

    ####################

    Strategy of these so called Muslims refugees brainwashed by rabid Mullahs with hate for Infidels seems to be to make Europe IMPLODE and CRUMBLE from within. Refugees do not have any gratitude for countries that give them refuge. These jihadis just use this as an opportunity to Islamize and Destroy their Host nations.

    UK is almost a gone case now with many of its Major towns and cities which are becoming Muslim Majority places where non-muslims are not safe anymore. France, Belgium, Norway, Denmark and Sweden is being taken over by wahabi / salafist Muslims. Germany did the biggest blunder and is now feeling the heat too.

    http://www.dailymail.co.uk/news/article-3424584/Muslims-UK-3-million-time-50-born-outside-Britain-Number-country-doubles-decade-immigration-birth-rates-soar.html

    India needs to adopt UNIFORM CIVIL CODE (UCC) and strict measures to control Muslim Population.

    At 2% to 5%, they begin to proselytize from other ethnic minorities and disaffected groups, often with major recruiting from the jails and among street gangs.

    From 5% - 10% on, they exercise an inordinate influence in proportion to their percentage of the population.

    At this point, they will work to get the ruling government to allow them to rule themselves (within their ghettos) under Sharia (Islamic Law). The ultimate goal of Islamists is to establish Sharia law over the entire world.

    After reaching 20%, nations can expect rioting, jihad militia formations, sporadic killings, and the burnings of Hindu temples, Buddhist Monastries, Christian churches and Jewish synagogues.

    At 40%, nations experience widespread massacres, chronic terror attacks, and ongoing militia warfare.

    From 60%, nations experience unfettered persecution of non-believers of all other religions (including non-conforming Muslims), sporadic ethnic cleansing (genocide), use of Sharia Law as a weapon, and JIZYA (the tax placed on infidels).

    After 80%, expect daily intimidation and violent jihad, some State-run ethnic cleansing, and even some genocide, as these nations drive out the infidels, and move toward 100% Muslim.

    Every Nation and its Governing Leaders has the duty and responsibility to provide a Safe and Secure Environment for the nation's Future Generations.

    There is no point in trusting indian politicians to act as most of them are Vote Bank Appeasing Pseudo Sickulars who will sell this nation to get votes from Sickular Vote banks. Most political parties do not care if India goes to the dogs. Most of the politicians do not have any knowledge of History and do not learn from the past mistakes and they commit the same Blunders again and again for short term political gains.

    What is happening in Europe is a proof that Development alone cannot protect its Nation from subtle infiltration and Evil Invasion that can Explode a Nation from within. A Nation that forgets its History and does not show interest in protecting its Civilization, Religion, Culture and Traditions will be destroyed.

    India needs more dedicated Desh Bhakt Organizations and Patriotic Think Tanks that must device Plans and Strategies to counter INTERNAL & EXTERNAL threats and safeguard India's future and protect our National security, Integrity and Sovereignty.

    PREVENTION IS BETTER THAN CURE.

    ReplyDelete
  7. Dear Captain,

    I read an interesting article that most Shiva Temples are aligned at longitude 79.3 or near about it. E.g. Kanchipuram Ekambareswara Temple and Kalahasti Shiva temple fall in the same Longitude in a Straight Line, even Badrinath is at 79.49° and Kedarnath at 79.04°

    Sir what are your expert views about it.

    Regards,
    Kunwar

    ReplyDelete
  8. In addition to previous question, here is another article http://news.indianservers.com/mystery-shiva-temples-line/

    ReplyDelete
  9. http://timesofindia.indiatimes.com/city/delhi/Hunt-on-for-Qureshi-who-made-Kerala-youth-join-IS/articleshow/53294284.cms

    in north kerala there are rabid islamic evangelists who drive wedges by preaching hardcore SHIRK

    muslims must know that the concept of allah is a straight lift form brahmAn , the hindus god which cannot be detected by the 5 senses. the beej mantra of sahasrara chakra is AL AH.

    Allah has said: "Do not establish two Gods : He is the only One Allah, worth worshipping : then fear Me (and Me alone)." (Surah No. 16, Al Nahl, Ayat No. 51)

    this is taken to the extreme of shunning all those who are non-muslims and condemning their faiths. even loyalty to the watan becomes SHIRK.

    SHIRK was poison injected by jews .

    if you go to mecca/medina and see the pathetic condition of the graves of mohammad and his nearest and dearest relatives --you come to know what SHIRK is all about

    this is what prevents some muslims from even saying BHARATMATA KI JAI.

    AND WHO ARE THESE PREACHERS ?

    THEY HAVE PRAYER MARKS ON THE FOREHEARD OUT OF DECADES OF PUTTING THEIR FORHEADS ON THE GROUND , 5 TIMES A DAY

    BUT THE BLACK CALLOUSED SKIN ( ZEBIBA ) IS ON THE WRONG PLACE.

    if you sprinkle white talcum powder on the ground where they pray , the white mark will be far away from the black ZEBIBA mark on their foreheads . .

    http://ajitvadakayil.blogspot.in/2011/07/cracked-heels-and-prayer-marks-capt.html

    capt ajit vadakayil
    ..

    ReplyDelete
    Replies
    1. Hi Captain,

      A muslim guy had once played out this trick on me in school when i was 10, he told me rub vigorously on forehead with thumb for one hour then hanumanji will appear on your head. I tried it next day, the mark came up was on for a month or so.

      Delete
    2. Captain our Hyderabad boy roht khandelwal became the first Indian to win Mr world 2016

      What's ur take

      Media ,online and offline is not going as crazy as it should

      I posted and made their hypocrisy virla

      Delete
  10. http://timesofindia.indiatimes.com/city/delhi/Hunt-on-for-Qureshi-who-made-Kerala-youth-join-IS/articleshow/53294284.cms

    in north kerala there are rabid islamic evangelists who drive wedges by preaching hardcore SHIRK

    muslims must know that the concept of allah is a straight lift form brahmAn , the hindus god which cannot be detected by the 5 senses. the beej mantra of sahasrara chakra is AL AH.

    Allah has said: "Do not establish two Gods : He is the only One Allah, worth worshipping : then fear Me (and Me alone)." (Surah No. 16, Al Nahl, Ayat No. 51)

    this is taken to the extreme of shunning all those who are non-muslims and condemning their faiths. even loyalty to the watan becomes SHIRK.

    SHIRK was poison injected by jews .

    if you go to mecca/medina and see the pathetic condition of the graves of mohammad and his nearest and dearest relatives --you come to know what SHIRK is all about

    this is what prevents some muslims from even saying BHARATMATA KI JAI.

    AND WHO ARE THESE PREACHERS ?

    THEY HAVE PRAYER MARKS ON THE FOREHEARD OUT OF DECADES OF PUTTING THEIR FORHEADS ON THE GROUND , 5 TIMES A DAY

    BUT THE BLACK CALLOUSED SKIN ( ZEBIBA ) IS ON THE WRONG PLACE.

    if you sprinkle white talcum powder on the ground where they pray , the white mark will be far away from the black ZEBIBA mark on their foreheads . .

    http://ajitvadakayil.blogspot.in/2011/07/cracked-heels-and-prayer-marks-capt.html

    capt ajit vadakayil
    ..

    ReplyDelete
  11. WARNING - -

    WHEN WORLD WAR 3 STARS , SATELLITES WILL BE TAKEN OUT IN THE FIRST COUPLE OF HOURS . .

    GPS WILL NOT BE AVAILABLE . .

    CRUISE MISSILES/ FIGHTER JETS AND DRONES WILL THEN HAVE TO RELY ON TERRAIN MAPPING ELECTRONIC CHARTS FOR NAVIGATION. . TO USE BY DEAD RECKONING MODE / RADAR TRIANGULATION ..

    IN INDIA OUR MILITARY SECRET ZONES HAVE ALREADY BEEN MAPPED BY FOREIGN DRONES --BECAUSE OUR NAIVE GOVT WAS GA GA OVER DRONES DELIVERING THINGS LIKE PIZZAS.

    THERE IS NO SYSTEM TO AUTOMATICALLY SHOOT DOWN UNIDENTIFIED AND UNAUTHORISED DRONES

    NOW THIS NEW POKEMON GAME IS BEING USED TO MAP STREETS AT GROUND LEVEL.

    ROBOTS WITH BOMBS CAN BE DROPPED TO AUTO NAVIGATE ENTER ANY SHELTERED BUILDING , WITHOUT GPS . . AFTER A EMP ATTACK . .

    https://www.youtube.com/watch?v=MRLRQPjMX_A

    READ ALL 4 PARTS OF THE POST BELOW

    http://ajitvadakayil.blogspot.in/2015/11/world-war-3-sans-gps-and-emp-taken-out.html

    BAN THIS POKEMON GAME IN INDIA.

    DOES PARRIKAR / MODI HAVE GOOD ADVISERS ?

    PUT THIS IN PARRIKARs, RAJNATH SINGHs, MODIs WEBSITES . .

    capt ajit vadakayil
    ..

    ReplyDelete
    Replies
    1. Namastey captain
      There are many offline apps maps of india.
      Even these are free.it can be misuse.

      Delete
  12. http://indiaarising.com/for-the-first-time-in-50-years-india-deployed-tanks-on-chinese-border-56-inch-chest-rocks/

    Hi Capt,

    As u predicted Modi is dragging India in to Indo-China WAR.

    Regards,
    Santosh.

    ReplyDelete
    Replies
    1. IN 17 YEARS INDIA WILL BE NO 1 SUPERPOWER ON THE PLANET.

      CHINA WILL BE NO 2

      USA WILL BE A DISTANT THIRD

      THE WHITE MAN WILL NEVER ALLOW A BROWN / YELLOW SKINNED MAN TO LORD OVER HIM.

      THEY WILL MAKE INDIA AND CHINA FIGHT AND DESTROY EACH OTHER.

      THIS IS HOW A FEW THOUSAND WHITE MEN RULED THE WHOLE OF INDIA- HUNDREDS OF MILLIONS OF US. WE HAD TRAITORS AMONGST US .

      EVEN AFTER ROTHSCHILD LEFT INDIA , HE TRIED TO RULE INDIA BY PROXY BY HAVING HIS CRYPTO JEW KINGS RULING KINGDOMS

      nizam of hyderabad was a cryto jew

      http://ajitvadakayil.blogspot.in/2013/04/razakers-of-mim-operation-polo-to-annex.html

      Delete
  13. Sir
    Please tell "DURGA SAPTISHITI AND ADITYA HRIDAY STROTAM ARE ALSO POISON INJECTED"

    ReplyDelete
  14. Hello Sir.

    I recently heard one of your previous Vedic Chants video, it was divine! Can you please tell me some other videos, which are real Vedic chants (7000 years old), most of the youtube videos maybe fake, that's why I'm asking you.

    ReplyDelete
  15. http://swarajyamag.com/world/the-vedic-gods-of-japan

    ReplyDelete
  16. http://timesofindia.indiatimes.com/city/chennai/Gods-in-shackles-Plight-of-temple-elephants/articleshow/53298377.cms

    TEMPLE ELEPHANTS ARE TAKEN GOOD CARE OF.

    PEOPLE WATCH . .

    WE DONT NEED LIES FROM DESH DROHIS . . ..

    ReplyDelete
  17. http://www.femina.in/relationships/love-sex/5-things-that-ruin-postsex-bliss-11789.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    CHUTNEY MARYs HAVE NO TIME TO WASTE

    THEY NEED TO ENSNARE ANOTHER PICKLE JOHN .

    TOILET PAPER USED ON BOTH SIDES SELLING DIRT

    ReplyDelete
  18. http://www.femina.in/relationships/love-sex/terrible-sex-advice-you-must-never-listen-to-11799.html?utm_source=TOInewHP_TILwidget&utm_medium=referral&utm_campaign=TOInewHP

    "Go with whatever floats your boat, as long as you and your partner are sailing happily together. BDSM, threesomes, anal, etc—if you’re both okay with it, it’s all good"

    THIS IS FROM A NATIONAL NEWSPAPER

    ALL THIS IS ON THE RISE EVER SINCE BJP TOOK OVER POWER

    THIS DIRT FIRST STARTED WHEN VAJPAYEE BECAME PM

    ReplyDelete
    Replies
    1. SO WHAT IS BDSM WHICH TOILET PAPER WANTS INDIANS TO FOLLOW ?

      https://en.wikipedia.org/wiki/BDSM

      TOILET PAPER RECOMMENDS THREESOME --

      SHAME ON THE MODI GOVT --FOR NOT HAVING THE BALLS TO STOP THIS NONSENSE

      NOBEL PRIZE MAANGTHA HAI NA ?

      Delete
  19. http://www.femina.in/relationships/love-sex/4-steps-to-a-real-good-quickie-11379.html

    check out some more written by this kalank to womenhood Suchita Parikh Mundul.

    http://www.femina.in/relationships/love-sex/4-steps-to-a-real-good-quickie-11379.html

    http://www.femina.in/relationships/love-sex/should-you-worry-that-he-wants-a-threesome-11255.html

    http://www.femina.in/relationships/love-sex/3-kinds-of-orgasms-you-need-to-experience-10730.html

    A megagasm involves an incredibly intense orgasm caused by vigorous physical stimulation (vaginal, anal, BDSM, what have you) and a bit of pain.

    AAARRRGGHHHH PPTTTHEEEOYYYYYYYYYYYY

    ReplyDelete
  20. http://timesofindia.indiatimes.com/Pay-your-tributes-to-Indian-hockey-wizard-Mohammed-Shahid/social/53298211.cms

    A GREAT HERO

    RIP!

    ReplyDelete
  21. http://timesofindia.indiatimes.com/india/Uneasy-calm-in-Kashmir-Valley-death-toll-rises-to-43/articleshow/53304085.cms

    KILL ALL THOSE ARMED DESH DROHIS WHO WAVE THE PAKISTANI FLAG

    PELTING STONES MUST BE EQUATED WITH "INTENT TO KILL"

    ReplyDelete
  22. http://timesofindia.indiatimes.com/india/Mayawati-is-worse-than-a-sex-worker-BJP-leaders-shocker/articleshow/53300418.cms

    THIS IS THE PITS !

    CENSURE THIS MAN .

    ReplyDelete
  23. Captain what is this extreme level of sadism
    Disturbing Hickok
    https://twitter.com/ayushsh08752765/status/755728964698726400

    ReplyDelete
    Replies
    1. These boys should definitely be punished they must be muslims guessing through their language

      Delete
  24. Capt., Aren't Karan Singh and his descendants responsible for such a bad state of Kashmir today? This royal family openly supports Article 370.

    ReplyDelete
  25. http://www.sutrajournal.com/sanskrit-in-croatia-from-sarasvati-to-hrvati-by-james-cooper

    ReplyDelete
  26. Sir
    Put Che Guevara and one more great mind Pjotr Garajajev(Russian Biophysicist) in Vadakayil's list.

    regards

    ReplyDelete
    Replies
    1. hi gb,

      today modern science is getting to know how sanskrit mantras affect DNA.

      Sanskrit has emanated from human DNA.

      DNA have set rules just like Sanskrit .

      Pjotr Garjajev wrote- “Living chromosomes function just like solitonic/holographic computers using the endogenous DNA laser radiation.”

      He modulated certain frequency patterns onto a laser ray and with it influenced the DNA frequency and thus the genetic information itself. Since the basic structure of DNA-alkaline pairs and of Sanskrit are of the same structure, no DNA decoding is necessary.

      Sanskrit is the only divine language on this planet. DNA reacts to Sanskrit mantras.

      Genetic defects including homosexuality can be repaired by Sanskrit mantras.

      Chromosomes damaged by x-rays can be repaired. Russians captured information patterns of a particular DNA and transmitted it onto another, thus reprogramming cells to another genome.

      They have transformed, frog embryos to salamander embryos simply by transmitting the DNA information patterns!

      Entire information was transmitted without any of the side effects or disharmonies encountered when cutting out and re-introducing single genes from the DNA. This shocking discovery was known to ancient Indians and written down 7000 years ago.

      There is amazing power in the longitudinal waves of Sanskrit mantras. Wave genetics, has an astounding influence on the formation of organisms than the biochemical processes of alkaline sequences.

      A Sanskrit mantra is a word or a series of words , which produce longitudinal Scalar waves by resonating your Pineal gland and your DNA.

      Only Sanskrit mantras reprogramme your DNA--it can be done by other languages .Mantras must begin and end with OM . Mantra chanting must be done with intent, and a sense of gratitude to make it more powerful.

      The Phantom DNA effect -- the energy field of a DNA sample remains detectable by laser light even when the physical sample is removed. Russian scientists irradiated DNA samples with laser light. On screen a typical wave pattern was formed. When they removed the DNA sample, the wave pattern did not disappear, it remained.

      In Wave Genetics, the junk DNA functions at a rich infrastructure level of super codes and wave communication, realized in material form as crystalline structures–dynamic gene-holograms in liquid crystals of the chromosome continuum. What this model suggests is that the human gene is part of larger holograms (multiverse) of wave information reality.

      Hyper-communication, in the form of remote sensing, remote healing and telepathy, is a part of the human protocol.

      My wife is a Reiki super-grandmaster--I know the effects of scalar waves which travel faster than light , which cannot be shielded by Faraday cages. The human DNA can produce longitudinal scalar waves.

      Unlike ancient maharishis who had 12 strand NIL junk DNA--we nowhave 2 strand 97% junk DNA.

      Only 3% of our DNA is wrapped up in the spiraling double helix strand.

      After Dec 21st 2012, man has the opportunity to evolve himself and convert his 2 strand DNA ( 97% junk ) to 12 strand NIL junk due to torsion waves from cosmos.

      when a QUEEN bee/ ant is separated from the colonu , work still continues-business as usual--but the moment you kill the queen, all work goes PHUTTT in a second.

      Universe has no restrictions. We create the boundaries based on our beliefs. These boundaries limit our spiritual growth / inner development which affect our DNA and vice-versa.

      GOOGLE-

      DNA NASA

      what do you see on page 1 as item 1- among 10 million posts ?

      why?

      the world is waking up !!

      capt ajit vadakayil
      ..

      Delete
  27. Capt,

    For the first time in Indian Parliament, gutsy environment minister Anil Madhav Dave spoke about HAARP in detail and its contribution to global warming.

    ReplyDelete
  28. Dear Capt Ajit Sir,

    In the case of Autism kids, which mantras or Patanjali Sutras can do the most effective DNA repair for them and make them become normal with a definitive process/approach that can be general or flexible to add some customization for some groups of children. Can we work/research on this for the overall benefit of suffering parents of autistic children ?

    ReplyDelete
  29. http://timesofindia.indiatimes.com/india/Grant-a-large-degree-of-autonomy-to-JK-Chidambaram/articleshow/53306302.cms

    SORRY

    KASHMIRIS DONT DESERVE AUTONOMY AS LONG AS THEY HOLD GUNS AND PAKISTANI FLAGS . .

    WE THE PEOPLE OF INDIA WILL NOT ALLOW IT . . .

    WE KNOW THE BENAMI MEDIA AND COLLEGIUM JUDICIARY WANT TO WITHDRAW AFSPA AND IF POSSIBLE GIVE AWAY KASHMIR TO PAKISTAN . . WHISTLE BLOWERS HAVE GIVEN PROOF AGAINST DESH DROHIS. ALL IN GOOD TIME ..

    ReplyDelete
  30. http://timesofindia.indiatimes.com/life-style/relationships/ask-the-expert/How-do-I-tell-my-parents-that-I-am-gay/articleshow/53298144.cms

    TOILET PAPER OF INDIA

    USED ON BOTH SIDES

    ASK PICKLE JOHNS-- THEY KNOW THE MODUS OPERANDI

    ReplyDelete
  31. http://www.idiva.com/photogallery-relationships/20-arguments-that-every-married-couple-has/32075/1

    33 YEARS OF MARRIED LIFE

    NEVER FOUGHT

    NEVER SAID SORRY

    NEVER WISHED GOOD MORNING

    NEVER SAID SWEET NOTHINGS LIKE - DAHLING

    apology is a GLUE-- when there are NO cracks, do you need glue ?

    in 33 years of married life-- i forgot my wife's birthday 28 times. she never forgot my birthday even once.

    in 33 years of married life i forgot our wedding anniversary 29 times .

    i forgot the birthdays of my sons too--but my wife will remind me ONE minute past midnight.

    once i asked my dutch chief engineer ( an intelligent man ) why i forget such important days--- when i have a elephants memory for everything else.

    he pondered over it and said --

    " AJIT, YOU DONT THINK IT IS IMPORTANT -- JUST SHOWS THE STRENGTH OF THE FOUNDATION OF YOUR RELATIONSHIPS. IT CAN BE SHAKEN "

    TO THAT I WILL SAY --AYE !

    capt ajit vadakayil
    ..

    ReplyDelete
    Replies
    1. I feel so proud Capt. Because I am also like you hehe no sorry..no darling...no remembering anniversary date but she know it's there what it really take in the heart

      Delete
  32. Dear Sir,
    This is a major development in drone world.
    This is bound to have immense repercussions WORLDWIDE. ISRAELI DRONES ARE SOLD MOSTLY WORLD OVER. THIS ALSO SHOWS FAILURE OF IRON DOME.
    REVERSE TECHNOLOGY FOR DRONES ARE OUT.
    The IDF was forced to admit, on the record, that despite launching two missiles – two Patriot PAC-2 - and then sending an F-16 which fired another missile, they were absolutely incapable of “neutralizing” – not to mention identify – a drone that violated Israel’s airspace.
    A Syrian drone penetrated Israeli airspace on Sunday. Israeli Air Force detected the UAV, but three attempts to intercept it failed.

    https://southfront.org/israeli-air-force-fails-in-3-attempts-to-intercept-drone-flying-from-syria/

    Best Wishes.

    ReplyDelete
  33. Hello Captain,

    Were medival rajputs the descendents of the Huns, and Sakas? If not, then from where did non vegetarianism come into indian society?

    Milin Patel

    ReplyDelete
  34. Namaste Ajit sir,

    Thanks for providing such a wealth of knowledge.

    Could you please provide some information on the Sahaj Yoga given by Sri Nirmala Devi. People follow her and treat her as a Kalki Avataar. The Chakra principles are simplified by her. But I doubt that the people who follow it might have created another cult.

    Also, sir one more question when the Soul goes to another body then why we do Sharadha every year. The deceased person would have taken another life?

    Thanks
    Regards
    RA

    ReplyDelete
    Replies
    1. NIRMALA DEVI WAS WIFE OF SCI CHAIRMAN SRIVASTAVA.

      SHE IS JUST A ORDINARY WOMAN -- SHE IS NO KALKI OR EVEN A GURU

      Delete
  35. Replies
    1. ONLY CONSCIOUS HUMANS CAN GIVE BRAHMAN FEEDBACK ( SOUL MERGES WITH BRAHMAN AFTER MOKSHA )

      Delete
  36. Would like to share an incident...

    Few days back i saw a white man sitting under a tree in an unusual place... a very unknown small village in the outskirts of Delhi. I felt curious and stopped to ask him what was he doing there. He said he has come to research on Auto Rickshaw Metering and governmental regulation on it etc etc for his PhD degree!!! I thought what the heck!!! PhD in Rickshaw Metering and regulation.... Transport policy of India they wish to be PhD on!!! Why? These people don't have anything else to do? And then i realised that "the PhD" is only a pretext to be in India....he surely was for some other purpose. I wonder what!!!

    Prithvi Singh

    ReplyDelete
  37. I never could imagine that the white man could ever pronounce sanskrit chants with such clarity and intention. Wannabe gora gaands should die in "chullu bhar paani" now. The dirt of west is getting imported into indian minds and the westerners are now taking up whole indian civilization into their life. Shame on those Indians who dream of being a goraa gaand. Pathetic dumbheads they are!

    ReplyDelete
  38. Rahul menon
    July 25, 2016 at 9:03 AM

    Respected Sir,


    The demo was something like this https://www.youtube.com/watch?v=2xBVEM2iMns


    Is this just a marketing gimmick? Or does this have some real science behind it?

    Please share your wisdom on this topic.


    ###############

    Capt. Ajit Vadakayil
    July 25, 2016 at 10:29 AM

    I HAD FOOLED A GIRL IN MY GYM MANY YEARS AGO SAME WAY

    SRI SRI RAVISHANKAR FOOLED THE WHOLE OF IIT WITH HIS FAKE SHAKTI OIL -- THIS IS WHAT IITs ARE WORTH , THEY GET FOOLED BY ROGUES .

    Triple Sri called for a volunteer to come up on stage for a “patented” magic oil surprise demonstration.

    One of the students from the back rows of the auditorium was chosen to share the dais.

    The chosen volunteer, a male student wearing a black t-shirt with horizontal white stripes, was asked to extend his arm parallel to the floor, clinch his fist and resist the pulling down of his arm.

    Triple Sri gripping the volunteer’s arm near the wrist, was able to pull down his arm easily over and over again, much to the amusement of the naïve audience.

    He then produced from his pocket a small vial containing some oil.

    The volunteer was then asked to rub and spread this oil over his arm. After the volunteer took a step back and a deep breath to relax, the whole exercise was repeated again – except this time Triple Sri with his gargantuan paunch struggled quite hard to pull down the volunteer’s arm, amazing the vast audience.

    The volunteer, visibly impressed and believing that he had in fact become stronger in a matter of seconds after the application of the oil, went onto fall at the feet (cultural practice of surrender) of the extraordinary messiah Triple Sri.


    Following the thundering applause from his gullible audience, Mr. Ravishankar went on to urge stronger volunteers to come forth.

    The next male volunteer also went on to fall at the feet of Mr. Ravishankar after his new found strength.


    The frenzy in the arena attracted a male "skeptic" from the audience to volunteer.

    He was visibly unimpressed by the arm pull down test and the claim of instantaneous improvement of strength and vigor following the application of a few drops of oil.

    The skeptic boldly asked for permission to perform the same test on his own test subject on the dais.

    While the skeptic readied his subjects, Triple Sri changed his track and launched into a astounding theory for his precious oil.

    He spAke “one drop of poison can destroy the body. Can it not destroy? One drop of poison can destroy the immune system. No? HOOO ? No ? The reverse can also happen – one drop of nectar can also strengthen your body.”

    The stupefied audience gaped in awe.

    What happened afterwards was most hilarious . The “test subjects” chosen by the “skeptic” gave testimonies to the audience that they felt “something different,” and the skeptic had to agree, on the microphone, that he was convinced of the power of the messiah and his great oil.

    The gullible IIT Kanpur audience could NOT stop clapping. These are the same folks AAP’s Kumar Vishwas recites mindless non-veg Hindi poetry ( CHOO LAA is this poetry, is he a poet ? ) and gets these rustic North Indians in raptures.

    Some Shakthi Drops, are sold for 25 Euros in 30ml vials on Art of Living’s EU website.

    Triple Sri uses the reaction principle to trick all. Push , relax a muscle and then pull.

    Triple Sri’s oil which gives rocket boost in immunity and muscle strength is not even pseudo science – it is sheer fraud.

    THE PHOTOS ARE IN THE POST BELOW-

    SEE THE IIT STUDENT WITH BLACK T SHIRT WITH WHITE HORIZONTAL STRIPES ..

    http://ajitvadakayil.blogspot.in/2013/12/ipc-section-377-love-lust-perversion.html

    capt ajit vadakayil
    ..

    ReplyDelete

  39. Capt. Ajit Vadakayil
    July 25, 2016 at 12:16 AM
    MENSTRUATING WOMEN ARE CLAMOURING TO ENTER SABARIMALA WITH SUPPORT FROM COLLEGIUM JUDGES

    LORD AYYAPA HAD SWORN TO HIS FOSTER MOTHER THAT HE WILL NOT MARRY

    THE THREE FLASHES HAPPEN AT THE EXACT TIME OF BHISHMAs SOUL LEAVING HIS BODY IMPALED ON A BED OF ARROWS ( ICHCHA MRYTHU ) ON MAKARA SANKRANTI DUSK

    BHISHMA WAS A SWORN BACHELOR - HE TOOK A VOW SO THAT HIS FATHER CAN MARRY THE GIRL OF HIS CHOICE


    ReplyDelete
    Replies
    #########################

    राजेश सिंह रावत
    July 25, 2016 at 6:18 AM
    Awesome Sir, It is great.. thank you so much for your blessings

    LORD AYYAPA HAD SWORN TO HIS FOSTER MOTHER THAT HE WILL NOT MARRY

    THE THREE FLASHES HAPPEN AT THE EXACT TIME OF BHISHMAs SOUL LEAVING HIS BODY IMPALED ON A BED OF ARROWS ( ICHCHA MRYTHU ) ON MAKARA SANKRANTI DUSK

    BHISHMA WAS A SWORN BACHELOR - HE TOOK A VOW SO THAT HIS FATHER CAN MARRY THE GIRL OF HIS CHOICE

    one way if we consider Bhisma and Bhagwan Ayappa our ancestors their vow must be respected by people of bharat being their children.

    ReplyDelete
    Replies
    ###########################
    Capt. Ajit Vadakayil
    July 25, 2016 at 11:16 AM
    PARASHURAMA SET UP SYSTEMS IN SABARIMALA 6000 YEARS AGO.

    NO TELUGU TANTRI WAS INVOLVED-- RAHUL EASHWAR ( DARLING ON TV ) IS A DESCENDANT OF A TELUGU TANTRI-- HIS GRANDFATHER IS TELUGU TANTRI.

    TELUGU TANTRIS POPPED UP DURING THE RULE OF THE WHITE INVADER--ALONG WITH VAVAR MUSLIM AND VELUTHACHAN CHRISTIAN.

    TODAY HINDU PILGRIMS PRAY AT VAVAR MOSQUE "BEFORE" GOING TO SABARIMALA AND WHITE MAN VELUTHACHAN'S CHURCH "AFTER " SABARIMALA PILGRIMAGE.

    JEW ROTHSCHILD COKED UP IMAGINARY CONVERSATIONS BETWEEN 9TH AVATAR OF VISHNU AYYAPPA AND MUSLIMS/ CHRISTIANS TO SHOW THAT AYYAPPA IS A MERE MORTAL AND THAT TOO A RECENT ONE

    PARASHURAMA WAS EXTREMELY PARTIAL TO NAMBOODIRIS- THERE IS NO WAY HE WAS EVEN ALLOW TELUGU BRAHMINS TO COME NEARBY SABARIMALA

    http://ajitvadakayil.blogspot.in/2011/10/worst-racists-on-planet-earth-capt-ajit.html

    PARASHURAMA TRIED TO MAKE BHISHMA MARRY AMBA -- BHISHMA REFUSED AS HE HAD MADE A SOLEMN WOW TO HIS FATHER .

    AFTER SEVERAL DAYS OF BATTLE PARASHURAMA DECLARED A DRAW --AMBA JUMPED INTO THE HOMAM FIRE IMMEDIATELY-- PARASHURAMA HAD A GUILTY CONSCIENCE.

    SABARIMALA IS FOR AYYAPPA AND BHISHMA --PEOPLE OF DHARMA WHO VALUES THEIR WORDS .

    PARASHURAMA CONSECRATED THE AYYAPPA IDOL AND SET UP THE TIMING OF THE 3 FLASHES --THE EXACT TIME OF BHISHMAs SOUL LEAVING HIS BODY TO VAIKUNTA.

    THIS ORIGINAL IDOL OF PANCHLOHA ( INCLUDING IRRIDIUM/ METEORITE IRON ) WAS STOLEN BY THE WHITE INVADER.

    http://ajitvadakayil.blogspot.in/2011/01/sabarimala-makara-vilakku-makara.html

    http://ajitvadakayil.blogspot.in/2013/01/sabarimala-makaravilakku-three-light.html

    IMHOTEP IS THE PATRON SAINT OF FREEMSONS AND JEW ROTHSCHILD.. HE DOES NOT KNOW THAT IMHOTEP IS AYYAPPA .. VINAASHA KALE VIPAREETA BUDHI . .

    http://ajitvadakayil.blogspot.in/2011/08/imhotep-patron-saint-of-freemasons-capt.html

    capt ajit vadakayil
    ..

    ReplyDelete
  40. abhishek prasannan
    July 5, 2016 at 12:33 PM

    Capt,

    Who is this Veluthachan?


    ###############################
    Capt. Ajit Vadakayil
    July 5, 2016 at 1:25 PM

    hi ap,

    JEW ROTHSCHILD INSERTED BUDDHA AS THE NINTH AVATAR OF VISHNU AND DELECTED AYYAPPA.

    THEN HE CREATED AND BACKDATED TWO FAKE CHARACTERS WHO WERE FRIENDS OF AYYAPPA—TO MAKE AYYAPPA A RECENT PHENOMENON.

    ONE WAS MUSLIM VAVAR MUNI—AND HINDUS PILGRIMS ARE FOOLED EVEN TODAY TO VISIT THIS VAVAR MOSQUE BEFORE GOING TO SABARMALA

    THE OTHER IS A CHRISTIAN VELUTHACHAN – AND HINDUS PILGRIMS ARE FOOLED EVEN TODAY TO VISIT A CHURCH AT ARTHUNKAL AFTER GOING TO SABARIMALA.

    SABARIMALA NEVER HAS ANY TELUGU BRAHMINS .

    RAHUL EASHWARS GRANDFATHER IS A TELUGU BRAHMIN ( Kandararu Maheshwararu )

    THEY GIVE BULL ABOUT TELUGU BRAHMINS MEETING LORD PARASHURAMA – NONSENSE !

    RAHUL EASHWAR IS NOW A DARLING OF BENAMI MEDIA—LIKE ARUN JAITLEY.

    Rahul Eashwar did Global Leadership at the London School of Economics—and he is being groomed to be a SICKULAR Hindu leader.

    APPARENTLY RAHUL EASHWAR WANTS ZIONIST JEW SUPPORT--THIS IS WHY HE IS PRETENDING TO BE A "SOFT" SICKULAR , WHEN HINDUISM IS BEING DECIMATED . ..

    THE STORY IN THE LINK BELOW OF TELUGU TANTRIS BROUGHT TO KERALA BY PARASHURAMA IS BULLSHIT.

    http://www.ayyappasamaaj.org/apps/blog/show/6195305-sabarimala-thanthri

    STORY: In order to protect and conduct rituals at these temples, from the banks of the holy river Krishna, he brought two brothers who were Tapasvis (ascetic persons who have undergone rigorous rituals of Tapas). This was sometime in the year 301 AD. The rights of Thantries were conferred on these two brothers of the families of Thazhamon and Tharananallur. Thazhamon family was given hereditary rights to the the Dharma Sastha temples while the Tharananallur family was given hereditary rights to the other temples. In order to distinguish who has the rights to which temple, the horizontal staff of the Holy Flag Post (Kodimaram) of each temple controlled by the Thazhamon family points to the North, while that of Tharananallur family points to the South.

    As to how the names Thazhamon and Taranallur came into being, here is the story:-

    When Parashuram was escorting these two elected pure brahmins ( TELUGU PURITY-- TEEE HEEEE )to the new land of Kerala, he came across a river. He thought it an ideal time to test the abilities of the two brahmins. He asked both to cross the river. The first one walked across the water. `Taranam' in Sanskrit means `traverse' or `cross'. Because he traversed the water, he and his successors earned the name of `Tarananallur'. The second brahmin made the waters part and traversed through the river bed. `Thazhamon' means the sand at the bottom. He and his successors earned the name of `Thazhamon`and the title of `Kantar'. Thazhamon Madom thantries were given charge of the Sastha temples while the Tarananallur thantires were assigned to the Devi temples, especially in north Kerala. UNQUOTE

    Capt ajit vadakayil
    .

    ReplyDelete
  41. Sanathan Dharm
    July 25, 2016 at 1:03 AM

    Captain people are saying Ajit Doval made Nepal PM resign. Can India pull off such big task with such short time?

    ReplyDelete
    Replies
    ###########################
    Capt. Ajit Vadakayil
    July 25, 2016 at 11:43 AM

    JNU COMMIE PROFESSORS ARE INVOLVED IN THE PLOT TO ASSASSINATE GADDAFI AND THE NEPAL ROYAL FAMILY MASSACRE -- USING JNU COMMIE STUDENTS . .

    JNU student ali zeidan became PM of libya

    JNU student baburam bhattarai became PM of nepal

    why modi govt is soft on JNU commie professors-- which force ties up his hands ---this blogsite knows!

    ALL IN GOOD TIME

    capt ajit vadakayil
    ..

    ReplyDelete
  42. DRAK
    July 26, 2016 at 5:50 AM

    Captain,

    Your points about this hype on celibacy by some gurus(Vivekanand,etc) is spot on!
    Infact many years ago I had read that "Brahmacharya" means being/living in/near Brahma, not withholding semen.

    However, one point needs clarity- wasn't the system of Dashnami Sanyasis and taking Sanyas Deeksha started by Adi Shankaracharya himself ??

    Even Vivekananda was initiated into Dashnami Sanyas order. These are the ten orders who give Sanyas with surnames like "Giri", Saraswati", etc.

    So, why did Adi Shankaracharya make this system of Sanyas for people of Grahastha age/ Brahmcharya age??

    Pranam.

    ReplyDelete
    Replies
    ###############################
    Capt. Ajit Vadakayil
    July 26, 2016 at 9:53 AM

    hi d,

    The white invader wrote that Adi Shankaracharya established the Dasanami Sampradaya 1200 years ago. Adi Shankaracharya died 4000 years ago.

    Crypto JEW homosexuals were put as Shankaracharyas of FAKE and backdated mutts created by Jew Rothschild. Sanatana Dharma was hijacked by agents of the white invader.

    They started celibacy ( with women only ), untouchability, animal sacrifices, devadasis , sati , aghori, and all fake traditions. In the four original mutts set up by Adi Shankaracharya only Namboodiris were allowed as heads or acharyas .

    Before the white invader came to India we never heard of sects like Aranya, Ashrama, Bharati, Giri, Parvata, Puri, Sarasvati, Sagara, Tirtha, and Vana. Adi Shankaracharya had nothing to do with this dashnami sampradaya.

    Dashnami sannyasins of above sects wore ochre-coloured robes and put CREMATION PYRE ASH on their foreheads- an unimaginable thing in Sanatana Dharma .
    The white invader wrote LIES that the 4 original mutts were for dashnami sects
    1. Govardhana Puri (Vana / Aranya )
    2. Dvaraka Pitha ( Tirtha, Aashram )
    3. Jyotirmath Pitha, Badrinath ( Giri, Parvat, Sagar)
    4. Sringeri Sharada Peetha ( Puri,Saraswati , Bharathi )

    http://ajitvadakayil.blogspot.in/2013/06/kanchi-mutt-creation-of-white-invader.html

    http://ajitvadakayil.blogspot.in/2014/01/my-visit-to-sringeri-mutt-exhuming.html

    FAKE GOTRAS –
    Puri, Saraswati, Bharati : Bhaveswa
    Tirtha, Ashram : Adhigata
    Ban, Aranya : Kashyap
    Giri, Parvat, Sagar : Bhrigu

    JEW ROTHSCHILD CREATED GOTRAS FOR CHITPAVAN JEWS NAY BRAHMINS TOO, WHO DID NOT HAVE A DROP OF BRAHMIN BLOOD IN THEM. NOBODY HEARD OF CHITPAVAN BRAHMINS BEFORE THE WHITE INVADER CAME TO INDIA.

    THE CHITPAVAN JEWS NAY BRAHMINS ( WHITE SKIN / PALE EYES / VERY MEAN ) WERE BENE ISRAEL JEWS FROM KERALA ( MATTANCHERY KOCHI ) WHO WERE DUMPED OFF THE COAST OF KONKAN FROM A ROTHSCHILD SHIP TO WADE ASHORE.

    THESE JEWS PROCREATED WITH LOCALS AND CREATE THE CHITPAVAN PESHWAS WHO WOULD USURP SHAHUS EMPIRE AND THEN RUN OVER INDIA , WITH ROTHSCHILDs GUNS TO SUBDUE THE MOGHALS AND SIKHS .

    MARATHAS HAVE WIND IN THEIR EARS. THEY CRY—WE ARE SO BRAVE , WE DEFEATED MOGHULS AND SIKHS. LIKE WISE SIKHS WITH WIND IN THEIR EARS CRY--WE ARE SO BRAVE , SIKH EMPIRE COULD NOT BE CONQUERED BY THE WHITE INVADER-- OH YEAH? ONLY BECAUSE MAHARAJA RANJIT SINGH HAD A TREATY WITH JEW ROTHSCHILD, WHO USED THIS KINGDOM AS A BUFFER FROM INVADING MUSLIMS .

    YES INDEED —WITH ROTHSCHILDs GUNS!

    http://www.kokanastha.com/htm/adnave.htm

    HERE IS A BOMBSHELL- VIVEKANANDA HAD CHRONS DISEASE ( A JEW MONOPOLISED DISEASE )

    capt ajit vadakayil
    ..

    ReplyDelete
  43. STOP PRESS :

    kancha ilaih SQUEAK nay shephard came on TV couple of years ago.

    he was cracking up from within-- his voice quivered with sheer grief when he cried--THESE HINDU GODS ARE SO VIOLENT, THEY ARE ALL THE TIME KILLING PEOPLE

    to this SQUEAK i must say " hindus gods are all cosmic allegories except vishnu avatars "

    stop moaning that Brahmins did NOT allow shudras to learn vedas – this would be as irresponsible as a brain surgeon allowing his nurse to do brain surgery on a holiday .. vedas went on the oral route for 300 centuries, without losing a syllable , before they were penned down 70 centuries ago ..

    CONDENSATION DOES NOT KILL EVAPORATION--THIS IS A CONCEPT MEANT FOR THE WISE--NOT IDIOTS.

    http://ajitvadakayil.blogspot.in/2015/09/sanatana-dharma-hinduism-exhumed-and.html
    devdutt pattanaik who does NOT understand sanatana dharama comes on TV serials aand denigrated hindusim.

    he thinks that hindu gods are mortals , and their vahanas ( vimanas ) animals and birds.

    see the way amish tripati converted shiva to be a tribal sex started mortal and the white man loved him for it.

    devdutt pattanaik's attitude towards hinduism can be gauged from the post below--

    read the part n blue italics- where shiva is hiding from nandi bull who is waiting in ambush to rape shiva anally . . . reciprocation if you please . .

    http://ajitvadakayil.blogspot.in/2014/01/nandi-bull-vahana-and-gatekeeper-of.html

    if he did the same in saudi arabia to islam he would have been beheaded on the streets within an hour.

    this blogsite asks TIMES OF INDIA e-newspaper to stop denigrating Hinduism daily vide its SPIRITUALITY COLUMN.

    devdutt pattanaik must know there is no heaven and hell in Hinduism.

    somebody asked me about old people-- even from kerala-- going to KASHI GHATS to die.

    well in olden days due to the saraswati river underground component, there was a MOBIUS COIL water flow at the ghats . people whose souls departs from this massive SCALAR FIELD gets a boost of ONE astral layer

    same with kailash mountain-- pandavas walked to mount kailash before they died.

    pyramid shaped mount kailash has an ORGONE FIELD due to the golden mean of 1.618 .

    http://ajitvadakayil.blogspot.in/2010/12/secrets-of-egyptian-pyramids-revealed.html

    THIS BLOGSITE WARNS JNU COMMIE PROFESSORS, NOT TO COOK UP FALSE STORIES ABOUT SANATANA DHARMA . .

    WE DONT WANT COMMIES TO SAVE INDIA..

    capt ajit vadakayil
    ..

    ReplyDelete
  44. he Benami media have got instructions from their foreign masters to praise Mother Teresa , as she will be made a saint tomorrow . .

    Even PM Modi will jump into the bandwagon .. .

    Karo bhaiyya , make this evil woman a god , who cares ? ..

    http://ajitvadakayil.blogspot.in/2011/02/diabolical-ministering-angel-mother.html

    CHRISTIANITY IS ROOTED IN FOUL LIES . . .

    http://ajitvadakayil.blogspot.in/2015/10/true-founder-of-christianity-jesus.html

    This religion has destroyed mankind and killed maximum people . .

    http://ajitvadakayil.blogspot.in/2016/03/st-patrick-genocide-of-druids-pope-leo.html

    KARO BHAIYYA !

    Know the truth how Christianity was spread on this planet . .

    http://ajitvadakayil.blogspot.in/2012/07/fransisco-pizarro-hernan-cortez.html

    http://ajitvadakayil.blogspot.in/2013/01/christopher-columbus-father-of-american.html

    capt ajit vadakayil
    ..

    ReplyDelete

  45. Capt. Ajit VadakayilSeptember 5, 2016 at 11:06 PM
    nobeatingroundthebush
    September 5, 2016 at 10:13 PM

    Keith Vaz British MP and friends of some very famous anal sex promoting Indians caught with his pants down with male prostitutes.....LOL......

    ReplyDelete
    Replies
    ############################

    Capt. Ajit Vadakayil
    September 5, 2016 at 11:03 PM

    IN THE VIDEO KEITH VAZ ASKED THE MALE PROSTITUTES FOR POPPERS

    WANNA KNOW WHAT THIS IS ?

    AIDS CAME TO THIS PLANET DUE TO POPPERS USED BY GAYS FOR ANAL SEX . .

    Almost all male homosexuals in the West use nitrite inhalants (amyl nitrites, called "poppers"). On chemical tankers we have it , for use when we load isocyanates like TDI , MDI , PAPI etc.

    It comes in small glass ampoules that were crushed to release their vapors, and received the name "poppers" as a result of the popping sound made by crushing the ampoule.

    When there is a problem we crush Amyl Nitrite capsules 5 times at 15 second intervals and hold under nose of victim.

    http://ajitvadakayil.blogspot.in/2010/06/mdi-diphenylmethane-diisocyanate-bhopal.html

    Amyl nitrite is a vasodilator with the formula C5H11ONO.

    The homosexuals use it as an inhalant, to expands blood vessels, increase heart rate for the euphoric state , relax the involuntary muscles -basically the anal sphincter.


    The effects set in within a few seconds. There is NO time for foreplay in dirty toilets or dark corners in parks. They are more orgasmic oriented, as opposed to pleasuring someone.

    Before Amyl Nitrate came on the scene( to prevent painful anal fissures and ulcers ) in the gay community there was no AIDS.

    In the 1991 film The Doors, Jim Morrison, played by Val Kilmer, sniffs Amyl Nitrite from a glass ampule in an elevator immediately before gay sex. Morrison died at age 27.

    Inhaled nitrites interact freely with endogenous trivalent nitrogen compounds to produce carcinogenic nitrosamines. Virtually all the early homosexual patients later diagnosed with AIDS had used poppers. Nitrites act on blood vessels, the site of KS, AIDS-related KS [Kaposi’s Sarcoma] and are known to be mutagenic. Poppers are immunosuppressive.

    AIDS-related KS [Kaposi’s Sarcoma] lesions occur most often on the chest and face, especially the nose; those are the body areas most heavily exposed to nitrite vapors. Persistent anal-rectal sexual activity can lead to various pre-cancerous lesions such as Bowen’s disease and Kaposi’s sarcoma.

    Whenever tissues are traumatized, cracked, or abraded, they are vulnerable to bacterial infection, especially when shit is just around the corner.

    FOR MORE INFO ASK A CRYPTO JEW BOLLYWOOD DIRECTOR WHO RELEASES HIS MOVIES IN ISRAEL TOO.

    HE SHOWED HIS FAVOURITE SEXUAL POSITION ( NAMAAZ TYPE POSITION ) IN A CROWDED HALL WITH HIS MOM SITTING IN THE FIRST ROW . .

    http://ajitvadakayil.blogspot.in/2013/06/hiv-does-not-cause-aids-many-aids.html

    capt ajit vadakayil
    ..

    ReplyDelete
  46. the WAHABBI/ SALAFI brainwash is - - -

    LIFE ON EARTH IS JUST A BRIDGE TO ATTAIN ETERNAL JANNAT ( ENDLESS BLISS IN HEAVEN WITH 72 VIRGINS )

    MARTYDOM FOR ALLAH BY KILLING NON-BELIEVERS SACRIFICING YOURSELF IN THE PROCESS --IS THE GOAL OF EVERY MUSLIM AS PER "SHIRK" SALAFI/ WAHHABI CRYPTO JEW PREACHERS ( LIKE LIKE HINDUS SAY MOKSHA BY GOOD KARMA IS OUR GOAL )

    IF THIS CAN HAPPEN IN A LITERATE STATE LIKE KERALA, GOD SAVE INDIA

    EVERY "SHIRK" PREACHER MUST BE PROFILED- THE GOVT MUST START DOSSIERS , RIGHT NOW

    ISIS WAS CREATED , ARMED AND FUNDED BY JEWS -- THE RECRUITMENT PROPAGANDA WAS HAJAAR SEX IN JANNAT WITH 72 VIRGINS!

    THERE IS NOTHING LIKE THIS IN KORAN . .

    AL SAUD IS A CRYPTO JEW RACE INSTALLED BY JEW ROTHSCHILD ON SAUDI THRONE.


    The number 72 applied to a good man deserving heaven.

    Like in Hinduism a Jivan Mukt ( who was buried and NOT cremated ) had a perfectly balanced BODY/ MIND / SPIRIT .

    This was possible by PRANA flowing free and pure through his 72 MAJOR nadis.

    "Through one of these, the Udâna leads us upward by virtue of good deeds to the good worlds, by sin to the sinful worlds, by both to the worlds of men indeed." (Prasna Upanishad Q3)- 5000 BC

    The TOP THREE being Shushumna , Ida and Pingala.

    I shall mention a few important nadis- Gandhari, Hastajihva, Kuhu, Saraswati, Pusha, Sankhini, Payasvini, Varuni, Alambusha, Vishvodhara, Yasasvin etc

    All of these 72,000 nadis do NOT have a physical manifestation--as they are meridian paths for energy..

    "A hundred and one are the arteries of the heart, one of them pierces the crown of the head. Going upward through that, one becomes immortal at death. Other arteries, going in different directions, only serve as channels for his departure from the body, ..." (Chandogya Upanishad -CU 8.6.6) 5000 BC

    These Nadis ( metaphysical meridians ) are kept primed by deep diaphragmatic breathing and by following the laws of the Universe.

    Surah Al-Waqia (56:35-37) of the Quran describes the houris as "most refined", created by Allah "in the best of form" and well-matched". This has NOTHING to do with deviant sex.


    Let me quote some POISON INJECTED ( by Jews ) Hadiths.

    The Jews have injected so much poison into Hinduism that this is just 0.001%.

    "The believer will be given such and such strength in Paradise for sexual intercourse".

    "The penis of the Elected never softens" and that men in heaven will have the sexual strength of 100 men"

    “Appetizing vaginas- non-menstruating / non-urinating/ non-defecating/ untouched / with hymen unbroken by sexual intercourse”

    “ Every male admitted into Paradise will be given eternal erections and wed to 72 wives, all with libidinous sex organs”

    “ Full breasted / large, round breasts which are not inclined to hang".


    “ Would not urinate, defecate, become pregnant or menstruate. Hairless except the eyebrows and the head"

    “ Round about the believers will serve, to them, young boys, who will be as pearls well-guarded. They will be served by immortal eternal young boys ... as fair as virgin pearls “ ( FOR ANAL SEX )

    “The marrow of the bones of their legs will be seen through the bones and the flesh."

    Jews have compared HOURI to WHORE.

    The number 72 comes only in the Hadith -- which has been poison injected by Jews --out of shape.

    http://weaselzippers.typepad.com/blog/2009/09/video-saudi-cleric-extols-the-virtues-of-allahs-virgins-in-paradise-they-are-white-women-who-are-men.html

    72 number is NOT there is the ORIGINAL FIRST WRITTEN Koran at Cheraman Perumal mosque by Namboodiri convert Malik Deenar and party.

    THE EDUCATED MUSLIMS OF INDIA MUST SAVE ISLAM . . .

    TODAY 99% OF MUSLIMS CHOLARS ARE FAKE --MOST OF THEM IN THE PAYROLL OF JEWS . . .

    even hafeez saeed has his ZEBIBA mark in the wrong place . . . .

    http://ajitvadakayil.blogspot.in/2011/07/cracked-heels-and-prayer-marks-capt.html

    capt ajit vadakayil
    ..

    ReplyDelete
  47. DJ
    October 17, 2016 at 2:21 PM

    Captain,
    Thanks for the wonderful insights on Agnihotra's benefits. Could you kindly throw some light on the subject of Aupasana. In what ways is it different from Agnihotra?

    ##############################

    Capt. Ajit Vadakayil
    October 17, 2016 at 3:16 PM

    in ancient days AUPASANA fires were maintained

    The son lights his aupasana fire during his marriage from his father's aupasana fire.

    The son's fire, like his father's, must be maintained throughout his life.

    BHISHMAs AUPASANA FIRE IS WHAT IS SHOWN AS THREE FLASHES AT SABARIMALA

    AMBA JUMPED INTO THIS FIRE

    WELL WELL , WHAT DO YOU KNOW

    PARSIS CAME WITH THE AUPASANA FIRE OF SHUKRACHARYA TO INDIA

    IN THE MOVIE DEVDAS , AISHWARYA RAI MAINTAINS ARE AUPASANA FIRE-- THIS FIRE CANNOT BELONG TO SHAH RUKH KHAN --AS HE IS NOT MARRIED

    BOLLYWOOD WITH CRYPTO JEW ISLAMIC INVASION HAS BROKEN EVERY ANCIENT RITE OF HINDUS

    AUPASANA FIRE HOMAM IS DONE BY HUSBAND AND WIFE TOGETHER EVERY SINGLE DAY-- THIS CONTINUING FIRE WITNESSED THEIR MARRIAGE --THEY HAD GONE AROUND IT.

    WHEN THE HUSBAND IS AWAY THE WIFE DOES THIS AUPASANA RITUAL ALONE USING AKSHATA RICE ( HAND POUNDED UNBROKEN GRAIN ) --THE VEDAS REQUIRE IT.

    AUPASANA HOMAM IS THE ONLY HINDU RITE A WOMAN CAN DO ON HER OWN--TWICE A DAY.

    AUPASANA FIRE KEEPS SOULS PURE. THERE WAS NO WORD CALLED DIVORCE IN THE SANSKRIT DICTIONARY.

    THE GLORY OF SANATANA DHARMA IS BEING SLOWLY EXTINGUISHED -- IN THE NAME OF SUPERSTITION.

    TAKING DEADLY CHEMICAL DRUGS FOR MENTAL DEPRESSION AFTER DIVORCE IS CALLED MODERN SCIENCE.

    WE HINDUS MUST NOT ALLOW THIS TO HAPPEN.

    http://ajitvadakayil.blogspot.in/2011/01/sabarimala-makara-vilakku-makara.html

    WHEN I WROTE MY POST ON KARVA CHAUTH, ALL PICKLE JOHNS AND CHUTNEY MARYs ATTACKED. THIS POST TRENDED ON TWITTER WORLD WIDE.

    http://ajitvadakayil.blogspot.in/2013/10/karva-chauth-synchronising-fertility.html

    WILL WANNABE GORA GAANDS EVERY UNDERSTAND THE MEANING OF GRATITUDE?

    THEY ARE NOT EVEN GRATEFUL TO THE WATAN.

    capt ajit vadakayil
    ..

    ReplyDelete
  48. Rahul menon
    October 18, 2016 at 10:44 AM
    Hello Sir,

    I came across an article The ‘Center of the universe’ located in Tulsa has an incredible acoustic anomaly that seems to defy the laws of physics..

    http://www.tulsaworld.com/weekend/music/what-is-tulsa-s-center-of-the-universe-landmark/article_9b843716-a654-54d4-8591-f29dc7fd5513.html


    What can be the real reason to this?

    ReplyDelete
    Replies
    #####################
    Capt. Ajit Vadakayil
    October 18, 2016 at 11:19 AM

    hi rm,

    THIS IS ACOUSTIC SCIENCE

    JUST OVER THE WALL OF MY PREVIOUS HOME IS CALICUT , WE HAD THE SCIENCE PLANETARIUM

    THERE THEY HAVE A CONCAVE SURFACE WHERE OF YOU WHISPER THE SOUND CARRIES LIKE A TELEPHONE WITHOUT WIRES.

    THIS IS SCIENCE

    INDRAPRASTA HALL BUILT BY MAYA DANAVA WAS FULL OF SUCH MAGIC ( REAL ACOUSTIC SCIENCE )

    WHEN DURYODHANA FELL IN THE THE POOL . DRAUPADI STOOD IN AMBUSH IN SUCH A CONCAVE FOCUS AREA AND WHISPERED " ANDHASYA PUTR ANDAHAH " THE SON OF THAT BLIND MAN IS BLIND TOO.

    THIS WAS ALLUDING THAT HIS FATHER KING DRITARASHTRA IS BLIND AND HIS MOTHER GANDHARI TOO HAD BLINDFOLDED HERSELF --BLIND PARENTS

    THERE COULD BE NO GREATER INSULT TO A GUEST KING

    THIS WOULD BE THE ROOT CAUSE OF MAHABHARATA WAR 6000 YEARS AGO.

    SOMETIMES MENTAL BLEEDING HURT MORE THAN ACTUAL BODY BLEEDING

    HINDU LTTE TOOK BIRTH ONLY BECAUSE SRI LANKAN BUDDHIST SOLDIERS SPRAYED AERATED SHIT ON TAMIL VILLAGES USING HELICOPTERS .

    LATER THIS LTTE MOVEMENT WAS HIJACKED AND HINDU PRABHAKARAN BECAME BRO PIRBHAKARAN AND HE NAMED HIS SON CHARLES

    LTTE SOLDIERS SPLIT AS THEY WOULD NOT AGREE TO BE BURIED , RATHER THAN BE CREMATED

    http://ajitvadakayil.blogspot.in/2012/08/aidmk-dmk-misplaced-support-for-ltte.html

    THIS WILL REMAIN THE MOST EFFECTIVE HEGELIAN DIALECTIC IN HISTORY--UNLESS WE DO SOMETHING LIKE THIS IN KASHMIR , BALOCHISTAN , NW FRONTIER AND SIND

    UNLIKE WHAT PEOPLE LIKE HYPER PATRIOT GEN ROY CHOUDHURY THINK -POLITICIANS WIN AND LOSE BATTLES

    CHANAKYA CONVERTED HIMSELF FROM ACADEMICIAN TO POLITICIAN

    HE WAS THE ULTIMATE POLITICIAN-- HE CAN NEVER EVER BE SURPASSED.

    HE CREATED AND MENTORED HIS OWN KING. THIS KING WOULD RULE THE WHOLE OF INDIA EXCEPT NAMBOODIRI CHANAKYAs HOMELAND OF KERALA

    http://ajitvadakayil.blogspot.in/2014/08/chanakya-taxila-university-professor.html

    THE MAP BELOW IS WRONG-- THE EASTERN COAST OF TAMIL NADU WAS UNDER THE RULE OF MAURYA EMPIRE.

    http://www.newworldencyclopedia.org/entry/Maurya_Empire

    BANGALORE , PALANI OF YAZIDIS ( BUILT BY CALICUT KING CHERAMAN PERUMAL ) AND SRINGERI MUTT WERE ALL PART OF THE ANCIENT CHERA EMPIRE.

    CHERA EMPIRE WAS THE RICHEST AND MOST BEAUTIFUL PART OF THIS PLANET. NOBODY DARED ATTACK IT, BECAUSE OF OUR KALARI TRADITION.

    PUNJABIS AND MARATHAS HAVE WIND IN THEIR EARS—THEY HAVE NO IDEA WHO A KERALA KALARI WARRIOR WAS.

    http://ajitvadakayil.blogspot.in/2011/12/kalaripayattu-oldest-and-deadliest.html

    FRENCH ROTHSCHILD GAVE ROCKETS AND LONG RANGE GUNS TO JEW TIPU SULTAN - AND THIS WAS THE FIRST TIME NORTH MALABAR WAS CONQUERED.

    THE CALICUT KING ZAMORIN COMMITTED SUICIDE OUT OF SHAME WHEN HE LOST THE BATTLE TO TIPU SULTANs FATHER JEW HYDER ALI -- HE BLEW HIMSELF UP

    https://farm1.staticflickr.com/70/175687868_e857872cc2_z.jpg

    ABOVE MANACHIRA POOL OF CALICUT WAS THE PLACE WHERE ROYAL WOMEN OF ZAMORIN FAMILY TOOK BATH . THIS IS THE CENTRUM OF CALICUT.

    capt ajit vadakayil
    ..

    ReplyDelete
  49. TEESTA SETALVADs GREAT GRANDFATHER CHIMANLAL HARILAL SETALVAD WAS A ROTHSCHILD STOOGE AND WAS KNIGHTED FOR WHITEWASHING THE JALLIANWALA BAGH MASSACRE

    INDIANS WERE SHOT FOR NOT CRAWLING OUT OF THE MAIDAN ON ALL FOURS , LIKE MONKEYS --WHEN ORDERED .

    HIS SON , TEESTA SETALVADs GRANDFATHER WAS INDIAs FIRST ATTORNEY GENERAL .

    CH SETALVAD AND BR AMBEDKAR WAS ONE TWOSOME -- SUPPORTING ROTHSCHILD 100%

    In late 1919, the British government got their loyal Sikh stooges to present a Saropa (Robe of Honour) to Lieutenant Governor of the Punjab Sir Michael Francis O'Dwyer .

    He was given the Saropa in Harimandar Sahib by CRYPTO JEW SIKHS wearing 5K -- a man who cheered the massacre of hundreds of innocent unarmed Hindus and Sikhs on Baisakhi day of 1919.

    This man who endorsed General Reginald Edward Harry Dyer's action regarding the Jallianwala Bagh massacre and termed it a "correct action "

    Sir Michael Francis O'Dwyer would be later assassinated by Udham Singh. He took in two bullets and died instantly.

    CHIMANLAL HARILAL SETALVAD had been knighted by Jew Rothschild, JUST BEFORE repeat JUST BEFORE the Jallianwala Bagh inquiry. He was the VC of Bombay University.

    Reginald Edward Harry Dyer returned to England as a great hero.

    IF I WERE TEESTA SETALVADs GREAT GRANDFATHER CHIMANLAL HARILAL SETALVAD I WOULD HAVE SENTENCED O'DWYER AND DYER TO DEATH.

    NOW YOU KNOW WHY HIS SON MC SETALVAD BECAME THE FIRST AND LONGEST SERVING ATTORNEY GENERAL OF INDIA . MAJJA HAI ... KISSI KOH KUCH NAHIN PATHA .

    Michael O'Dwyer, the Lieutenant Governor of Punjab from 1912 to 1919, endorsed General Dyer and called the massacre a "correct" action.

    SIKHS GAVE HIM SAROPA IN THEIR HIGHEST PEETH-- HARMANDIR SAHIB . THIS MAN O'DWYER HAD GIVEN ORDERS TO REGINALD DYER .

    WHITHER HONOUR ?

    http://ajitvadakayil.blogspot.in/2013/07/unknown-history-of-sikhs-and-sikhism.html
    THE KHALISTANI MOVEMENT WAS STARTED BY ROTHSCHILD USING CRYPTO JEW SIKHS WITH PALE EYES ( WEARING 5 K )

    VERY SOON THERE WILL BE "SIKH REGIMENT " IN UK AND CANADA.

    ALREADY UK SIKHS HAVE SAID "WE ARE NOT INDIANS"

    capt ajit vadakayil
    ..

    ReplyDelete
  50. http://www.inquisitr.com/3764223/stephen-hawking-warns-humanity-about-donald-trump-we-are-at-most-dangerous-moment-in-history-video/

    CAPT AJIT VADAKAYIL DECLARES

    STEPHEN HAWKINGS HAS DONE NOTHING FOR THIS PLANET .

    HIS USELESS THEORIES ARE HYPED UP BY JEW ROTHSCHILD-- JUST BECAUSE HE SUPPORTS PEA BRAIN JEW ALBERT EINSTEIN--A THIEF

    http://ajitvadakayil.blogspot.in/2014/08/yellapragada-subbarow-nobel-prize-and.html

    ALL OF JEW EINSTEINs MATH WAS OUTSOURCED TO INDIA..

    http://ajitvadakayil.blogspot.in/2011/11/satyendranath-bose-nobel-prize-and.html

    A REAL GENIUS WAS NIKOLA TESLA

    HE INVENTED AC ELECTRICITY AND MOTORS

    TESLA MADE ON DENT ON THIS PLANET

    BEFORE THE INTERNET AGE , NOBODY HEARD OF TESLA

    MY FIRST BLOGPOST WAS ABOUT TESLA --TODAY MY BLOGPOSTS NUMBER 1090 .

    I HAVE COVERED ALMOST EVERY SUBJECT ON THIS PLANET .

    I AM TODAY THIS PLANETs NO 1 WRITER --IN QUANTITY, AS WELL AS QUALITY

    IF ANYBODY HAS WRITTEN MORE WORDS ON THIS PLANET , LET ME KNOW. ( INCLUDE ONE LAKH SEVENTY THOUSAND COMMENTS TOO )

    I GUESS I HAVE NIKOLA TESLAs BLESSINGS -- HE WAS DELETED BY JEW ROTHCHILD

    A THIEF NAMES EDISON WAS PUSHED AHEAD BY JEW ROTHSCHILDs HISTORIANS -- A SON OF A BITCH !

    http://ajitvadakayil.blogspot.in/2010/11/edison-ace-delegator-cum-patent.html

    capt ajit vadakayil
    ..

    ReplyDelete